KEGG   Bacillus clausii: ABC2809Help
Entry
ABC2809           CDS       T00228                                 

Gene name
ligB
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bcl  Bacillus clausii
Pathway
bcl03030  DNA replication
bcl03410  Base excision repair
bcl03420  Nucleotide excision repair
bcl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ABC2809 (ligB)
   03410 Base excision repair
    ABC2809 (ligB)
   03420 Nucleotide excision repair
    ABC2809 (ligB)
   03430 Mismatch repair
    ABC2809 (ligB)
Enzymes [BR:bcl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ABC2809 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     ABC2809 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ABC2809 (ligB)
DNA replication proteins [BR:bcl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ABC2809 (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ABC2809 (ligB)
DNA repair and recombination proteins [BR:bcl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ABC2809 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     ABC2809 (ligB)
   MMR (mismatch exicision repair)
    Other MMR factors
     ABC2809 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2 B
Motif
Other DBs
NCBI-ProteinID: BAD65343
UniProt: Q5WE67
LinkDB All DBs
Position
2942719..2943552
Genome map
AA seq 277 aa AA seqDB search
MITIFISPMLLNRIDTPTENNWLTELKFDGIRLIMSKHDGLTRLYTRHKTEVTNRFPELC
NNDIADGTILDGELIVLNDDGQPDFELVMSRFRSSKTTPLLPVQFVVFDIIKHKHTCTTA
LPLIQRKEILSKVLRPHPHMTEIKWIEGQADAYFAAVKDRELEGIVIKNPTSTYKINKRS
DDWLKVINYQYTQGLITGYRKDEFGLLLESFEGESWGVMEHMELKQRKQFYQIAKMQNVT
EGKQFVHLETPLPCRIRYRNLTRKGYLRIPTFVDWLI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgataactatctttatttcccctatgcttttaaaccgaatagatacgccgacggaaaac
aattggctaactgaactaaagtttgacggcatacgcttgatcatgtccaaacatgacggc
ttaacacggctgtataccagacataaaactgaggttacaaaccgatttcccgaactgtgc
aacaatgatattgccgacggtaccattttagatggcgaactgattgtactaaatgatgat
gggcagcccgactttgagttggtcatgtctcgctttcgatcttccaaaacaactccccta
ctacccgtgcagtttgtggtttttgacataattaagcacaaacacacctgtactactgcc
ctacccctcatacaacgcaaagagattctttctaaagtattacgccctcacccccacatg
accgaaattaagtggatagaaggccaagctgacgcttattttgctgccgtaaaagacaga
gaattagaagggattgtcataaaaaatccaacgtctacttacaaaataaacaaacgatct
gacgattggctcaaagtcattaattaccagtacacacaaggtctgattacgggatatagg
aaagacgaattcggcttgctactagaaagtttcgagggcgagtcatggggagtcatggag
cacatggaacttaagcaacgtaagcaattttaccagattgctaagatgcagaatgtcact
gagggaaaacagtttgtacatttagaaacgccgctcccgtgtaggatacgttaccgcaac
ttaaccagaaaaggctacctacgcattccaacttttgttgattggctaatatga

DBGET integrated database retrieval system