KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4798Help
Entry
Bcenmc03_4798     CDS       T00669                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcenmc03_4798
Enzymes [BR:bcm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcenmc03_4798
Transporters [BR:bcm02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcenmc03_4798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACA93928
JGI: Bcenmc034798
UniProt: B1K4G9
LinkDB All DBs
Position
2:1822778..1823437
Genome map
AA seq 219 aa AA seqDB search
MMPTLYAHPFSSYCQKVLTALYENGTPFEYRVLAHDDPKPMQELTALWPLKRFPVLVDAG
RTVIEASIIIEYLGLAHPGPVRLLPDDPRAALEVRTMDRFFDNYVATPQQKVVFDALRPE
AERDARGVADARAMLDTSYAWLDKTMADREWAAGDRFSLADCGAAPFLFYADWTHRIDPA
FANVIAYRKRLLARPSFARAVDEARPYRSFFPLGAPDRD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgacgctttacgcccatcccttttcgtcctactgccagaaagtgctgaccgcg
ctgtacgagaacggcacgccgttcgagtatcgcgtgctcgcgcacgacgatccgaagccg
atgcaggaactcaccgcgctgtggccgctgaagcgcttcccggtgctcgtcgacgcgggc
cgcacggtgatcgaggcgtcgatcatcatcgagtatctcggtctcgcccatccgggcccc
gtgcgcctgctgcccgacgatccgcgcgccgcgctcgaggtgcgcacgatggaccgcttc
ttcgacaactacgtggcgacgccgcagcagaaggtcgtgttcgatgcgctgcggccggaa
gccgagcgcgatgcgcgcggggtggccgatgcgcgtgcgatgctcgacacgtcgtatgcg
tggctcgacaagacgatggccgatcgcgaatgggcggccggcgatcgtttcagcctcgcc
gattgcggcgcggcgccgttcctgttctacgcggactggacgcaccggatcgatccggcg
ttcgcgaacgtgatcgcgtaccggaagcgtctgctcgcgcggccgtcgtttgcacgcgcg
gtcgacgaggcacggccgtatcgttcgttctttccgctcggcgcgcccgatcgcgattga

DBGET integrated database retrieval system