KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6493Help
Entry
Bcenmc03_6493     CDS       T00669                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
bcm  Burkholderia cenocepacia MC0-3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3:548991..550793
Genome map
AA seq 600 aa AA seqDB search
MARAAVFLKGRTLVTKYASTIHRLIESLEDVAGAMHRMTFVDDAGHEAGITYRHFAEEVF
RQAGALRELGVRENDLVMLALPASVEHAAAMMACVMTGALPCTVPVPVRRAAAGRQVADV
ACELYRPRLVVAADAQAAAWRDDAFPAAATRVVDLATLSSAADAGARALISSKSGRDPHH
VQLTSGSTSHPKAAVLSHENVIANVLGIGGSVRFDIAAGDGTASWLPLYHDMGLLTLLSN
LHYRAPLLIMQPNSFIRNPLGWLKRIASARATTTSVPTFALRYCVRRFNAAAMDGVDLSA
CRNIFIGGERVDDATLRDFAATFAPYGLAASALQPCYGMAESTLAVSMHRAWHEGAVDGA
PYVIADTLDRRALIERRDAQPAAANDGQDTETETVLAMGTPIDGMAFRILDDGGHALANR
AVGEVAIRGTSVMLGYLNPDDGTIAAPLTADGWFRTGDIGYVADGQLHILGRKKEVIIIR
GSNYFPHEIEEALASHSALRKSTCIAFGLPDPETGTERLVVAIEARPVDATPQTRTECQQ
LLASRIGFAAQDLCFVEPGSLPRTTSGKLQRLKCRDLYANGALPVIPASAAVEAVQGAFA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgagcggccgtgttcctcaaggggagaaccctcgtgacgaagtacgcatccacc
attcaccgcctgatcgaatcgctcgaggacgtggcgggcgccatgcatcgcatgacgttc
gtcgacgacgcgggccacgaagcgggcatcacgtaccggcacttcgcggaagaggtgttt
cgccaggccggcgcgctgcgcgagctcggggtacgcgagaacgatctggtgatgctcgcg
ctgcccgcgtcggtcgagcatgcggccgcgatgatggcctgcgtgatgaccggcgcgctg
ccctgcaccgtgcccgttcccgtgcggcgtgcggcggccgggcgacaagtggccgacgtc
gcgtgcgagctgtaccggccgcgcctcgtggttgccgcggacgcgcaagccgcggcctgg
cgcgacgatgcgtttcccgcggccgccacgcgcgtggtcgatctcgcgacgctgtcgagc
gcggcggacgccggcgcgcgcgcactgatcagttccaagagcggccgcgatccgcatcat
gttcagctcacgtccggttcgacgtcgcatccgaaggccgcggtgctcagccacgagaac
gtgatcgcgaacgtgctcggcatcggcggatcggtgcgcttcgacatcgcggccggcgac
ggcaccgcgtcgtggctgccgctctatcacgacatggggctgctcacgctgctgtcgaac
ctgcattaccgcgcgccgctgctgataatgcagccgaacagcttcatccggaatccgctc
ggctggctgaagcgcatcgcgtcggcgcgcgcgacgacgacgtcggtgccgaccttcgcg
ctgcgctactgcgtgcgccgcttcaacgccgccgcgatggacggcgtcgatctgtccgcg
tgccgcaacatcttcatcggcggcgaacgcgtggacgacgcgacgctgcgcgatttcgcc
gcgacgttcgcgccgtacgggctggcggcatcggcgctgcagccgtgctacgggatggcc
gaatcgacgctcgcggtatcgatgcatcgtgcatggcacgaaggcgcggtcgacggcgcg
ccgtacgtgatcgccgatacgctcgatcgccgcgcgctgatcgagcgccgcgacgcgcag
ccggccgccgcgaacgacggccaggacacggagaccgaaacggtgctcgcgatgggcacg
ccgatcgacgggatggcgttccgcatcctcgacgacggcggccatgcgctcgccaaccgc
gcggtcggcgaagtcgcgatccgcggcacgtcggtgatgctcggctacctgaaccccgac
gacggcacgatcgccgcgccgctgacggccgacggctggttccgcaccggcgacatcggc
tacgtcgcggacggccagctgcatatcctcggccgcaagaaggaagtcatcatcatccgc
ggcagcaactatttcccgcacgagatcgaggaagcgctggcgtcgcacagcgcgctgcgc
aagagcacctgcatcgcgttcggcctgcccgatcccgaaaccggcaccgagcggctggtc
gtcgcgatcgaggcgcggcccgtcgacgcgacgccgcaaacgcgcaccgagtgccagcag
ttgctcgcgtcacgcatcggcttcgccgcgcaggatctgtgtttcgtcgaacccggctcg
ctgccacgcacgacgagcggcaagctgcaacgcctgaagtgtcgcgacctctatgcgaac
ggcgcgttgcccgtgatccccgcgtcggccgccgtcgaagcagtccagggagcgttcgca
tga

DBGET integrated database retrieval system