KEGG   Burkholderia cenocepacia AU1054: Bcen_4632Help
Entry
Bcen_4632         CDS       T00363                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcen_4632
Enzymes [BR:bcn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcen_4632
Transporters [BR:bcn02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcen_4632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2:complement(1896109..1896828)
Genome map
AA seq 239 aa AA seqDB search
MRRVRLRCRGTNDIQQGSNMESNARTTLTISSRNYSSWSMRGWLLAKLSGLTFETISVPI
DATSRAELLLLSPSILVPCLTHDGNAVWDTLAIAEYLNEIRPQARLLPEDRHARAHCRSI
CGEMHSGFSALRSALPMNLRGHFPGFRIWSRAQHDIERIVTIWRECLAEYGGPWLFGAEI
GIADAMYAPVVTRFLTYDVKLEPDVAEYCMRVLAHPFVAEWIEEAKAEHEDIDELDMEF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgtccgtttacggtgcaggggcacgaacgacattcagcaggggagcaacatg
gaatccaacgcacggacgacgctgaccatcagcagccgcaattattcgtcgtggtcgatg
cgcggctggttgctcgcgaagctgagcgggctcacgttcgagacgatcagcgtgccgatc
gatgcgacgtcgcgcgcggagctgctgctgctgtcgccgtcgattctcgtgccgtgcctg
acgcacgacggcaacgcggtgtgggacacgctcgcgatcgccgaatacctgaacgagatc
cgcccgcaggcgcggctgctgcccgaagaccggcatgcacgcgcgcattgccggtcgatc
tgcggcgagatgcattccggcttcagcgcgttgcgatccgcgctgccgatgaacctgcgc
gggcatttccccggcttccggatctggtcgcgcgcgcagcacgacatcgagcggatcgtg
acgatctggcgcgagtgcctggccgagtacggcggcccctggctgttcggtgcggagatc
ggcatcgccgacgcgatgtatgcgccggtcgtcacgcgctttctcacctacgacgtgaag
ctcgaaccggacgttgccgagtactgcatgcgcgttctcgcgcatccgttcgtcgccgag
tggatcgaggaggcgaaggccgagcacgaagacatcgacgagctcgacatggagttctga

DBGET integrated database retrieval system