KEGG   Bacillus cellulosilyticus: Bcell_2290Help
Entry
Bcell_2290        CDS       T01389                                 

Definition
(GenBank) D-alanine--D-alanine ligase
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2482977..2485121)
Genome map
AA seq 714 aa AA seqDB search
MKIAIVYNRESQAVINLFGTPNREKYGLETIKNIKNGLLAGGHQVKTFEGDKNIINKLED
FMPSVISGERPGLVFNLSYGIQGKGRYMHVPGILEMIGVPYVGSGPETHALALDKVVTKM
ILLQKGLPTPKFTVLDNPDSKFHEDLSYPLIVKPKNEAVSFGLKIVNNEEELRDGVKTIY
EKFNSPTLVEEYIEGREVNVGLLGNNPVEALPPVELVFGEGPQIYTFEDKKNKSGRTVEK
VCPAPISEELTKKVQQLAIDTFKALDCYDTARVDFRIDKEGNPYILEVNSMASLGADGSF
VFAADKVGLNYSDLMNRIVDITCERYFGPHFLMNTNEGAEKKGIDIFNSITNKRSKIESE
LKSWTNISSRTEDPVGLSAVQKKLDDRLKKLGLQLDADYTNGRSAWTWETKAGYKDGTLL
VVPIDVPGERTGFPIPYRTEQEWIYGEGVGSSRGGLVTLLTALSALKEQKALNKTKLGIF
FYSDEGRGMRYSNAMLKKAAKHAKEVIVLQPGFLGGKVADQRRGSKQFNIIVEGDPIRVG
KSTKTMDVLSYFIDKAEKLNSLSDKRKKLTVAVQEVRSERYSVLMPHRVKGTILISYLDE
EMAKEVENTIREIFRTNINGMQTYIEKLTERPPLLRKKKNTLLQKFKGLSEEWNIPFGTD
SSLLASAAGEISGDLQVVCGFAPASKELYTPNEAIHRSELIQRSLLLALYLLSE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgccattgtttataaccgagaaagtcaagctgtcattaatttgtttggtaca
cctaatagagaaaagtatggacttgaaacaattaaaaacataaaaaacggactattagca
ggtggacatcaagtaaaaacatttgaaggcgataaaaatatcataaataaactagaagac
tttatgccttcagttatttctggagaaagacctggcctagtattcaacttaagctacggg
attcaaggaaaagggcgttatatgcacgtacctggaattttagaaatgattggtgttcct
tatgtagggtctggtccagaaacacatgcattagcactggataaagtagtcactaaaatg
atacttttgcaaaaagggttacctacaccgaagtttacagtattagataatcctgactca
aaatttcatgaagatttatcatatccgttaattgttaaacctaaaaatgaagccgtttct
ttcggtttaaaaattgttaacaatgaagaagaattaagagacggtgtgaaaacgatatac
gaaaaatttaattccccaacgctcgttgaagaatatatcgaagggcgagaagtaaatgta
ggactgttaggaaataaccctgttgaggcactaccaccagtggaattagttttcggggaa
ggaccacaaatatatacgtttgaggataagaaaaataaaagtggaagaactgtggaaaag
gtttgtcctgcaccgatttctgaggaattaactaagaaggtgcaacaactagcaattgat
acatttaaggcacttgattgctatgatacagcgagagttgacttccggatagataaagag
ggaaacccatatattctagaagtgaattctatggctagtttaggcgcagatggttcattt
gtttttgctgcagataaggtcggattaaattattcagacttaatgaatcggattgttgat
attacttgtgaacgatatttcggaccacattttctcatgaacacaaacgaaggcgctgaa
aagaaaggcattgatatttttaattcaataacaaacaaacgaagtaaaattgagtcggaa
ttaaaaagctggacaaatatatcgagcagaacggaggaccccgttggtttaagtgccgtt
caaaagaaattagatgatcggttaaaaaagcttggactacaattagatgctgattataca
aatggtcgttccgcatggacatgggaaacgaaagcgggctataaagatgggactttactt
gtagtaccgattgatgttcctggcgaaaggaccggatttccaattccgtatagaacagag
caagagtggatatacggtgaaggcgtagggtcaagcagaggtggactagtaacactcctc
actgctctatctgcattaaaggagcaaaaggcattaaataaaacaaagctaggcattttc
ttctattcggatgaaggaagagggatgcgttacagtaatgcaatgttaaagaaggcagca
aagcacgctaaagaagttatcgtacttcaacctggtttccttggtggcaaagttgctgac
cagagacggggttcgaaacagtttaacattattgtcgaaggtgatccaattagagtaggg
aaatcaacgaaaacgatggatgtattaagctattttattgataaagctgaaaaattaaat
agcttaagtgataaaagaaaaaaattgacagtagctgtacaggaagtacgttcagagcgt
tatagcgtactcatgcctcacagagtaaaaggcactattctcatctcatatttagatgaa
gaaatggctaaggaggtagagaatactatacgtgaaatctttagaacaaatataaatggt
atgcaaacatatattgagaaattaacggaacgtccgccattattgcgaaaaaagaaaaac
actctgcttcaaaaattcaaaggtcttagtgaagaatggaatattccgttcggtaccgat
tcaagccttctggcaagtgcagcaggagaaattagtggagatttacaagtagtatgtgga
ttcgcacctgcaagtaaagagctatacacacctaacgaagcgatacacagaagtgaacta
atacagagatcattattgctagcactttatttattgagtgaataa

DBGET integrated database retrieval system