KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_2200Help
Entry
BF29_2200         CDS       T03712                                 

Definition
(GenBank) alpha amylase, catalytic domain protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF29_2200
Enzymes [BR:bcoa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BF29_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2133868..2135331
Genome map
AA seq 487 aa AA seqDB search
MERNHTIMQFFEWNTPADGSHWNRLKEMAPELKKSGIDAVWLPPVTKGQSDMDNGYGVYD
HYDLGEFDQKGTVRTKYGTKQQLHEAINACHEHDIQVYIDVVMNHKAGADETESFQVVEV
DPMDRNKEISEPFEIEGWTKFNFTNRKGKYSDFTWNHTHFSGVDYDNRTGRNGIFRIVGE
NKHWSEHVDNEFGNFDYLMYADIDYNHPDVKKEMIEWGKWLADTTGCDGYRLDAIKHINH
DFIRDFAAALMEHRGDHFYFVGEFWNPQLEACQKYLDHVQFKIDLFDVALHYKLHEASKK
GRAFDLTTIFHDTLVQTHPLNAVTFVDNHDSQPNESLESWVDDWFKQSAYALILLRKDGY
PCVFYGDMYGIGGDHPIPGKKGALSPLLSVRREKAYGEQDDYFDHPNTIGWVRRGVPEMP
HSGCAVVISNGENGEKRMLAGKERAGEVWVDATGNRQEKITIGEDGYAAFPVNGGSVSVW
VQETGEN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttggaacggaatcatacaatcatgcagttttttgaatggaatacgccagcagacggcagc
cattggaaccggctgaaagaaatggcgcctgaattaaagaaaagcgggattgatgccgtc
tggcttccgccggtgacaaaaggacagtcagacatggacaatggttacggggtgtacgac
cattacgacctcggggagtttgaccagaaaggcaccgtcaggacaaagtacgggacaaaa
cagcaattacatgaagcgatcaacgcctgccacgagcacgatatccaggtctatatcgat
gtcgtcatgaaccataaagcgggcgcggatgaaaccgaatctttccaagtggtggaggtc
gacccgatggatcgcaacaaagaaatttccgaaccgtttgaaatagaaggctggacaaag
ttcaattttacaaaccggaaaggcaagtattctgattttacgtggaatcatacccatttc
agtggcgtcgattacgacaaccggacagggcggaacggcattttccgtattgtcggggaa
aataagcattggagtgagcatgttgacaacgaatttggaaactttgattacttgatgtac
gcggacattgattacaaccatccggatgtaaaaaaagaaatgatcgaatggggaaaatgg
ctggccgatacgaccggttgtgacggctaccggctcgatgccattaagcatatcaaccat
gactttatccgcgactttgccgctgccttaatggaacaccgcggagaccatttttatttt
gtcggcgagttctggaatccgcagctggaagcgtgccaaaaatacctcgaccatgtccag
tttaaaatcgatttgttcgatgttgcactccattataaattgcatgaagcatctaaaaaa
gggcgcgcgtttgacctcacgacgatttttcatgatacactcgttcaaacgcacccgctg
aatgctgttacgtttgttgataatcatgattcacagccgaacgaatcgctggaatcatgg
gtggacgactggtttaagcagagcgcctatgctttgatcctgctgcggaaagacggttat
ccgtgcgtcttttacggggatatgtacggcatcggcggcgaccatccgattcccggaaaa
aaaggcgccctttccccgcttttatctgtccggcgggaaaaagcgtatggcgagcaggat
gattattttgaccatccgaacaccatcggctgggtacgccgcggcgttccggagatgccg
cattccggctgtgccgtcgtcatctcaaacggcgagaacggcgaaaaaagaatgcttgcc
ggaaaagagcgcgctggcgaggtttgggtggacgccaccggcaaccggcaggaaaaaatt
acaattggcgaagacggctatgcggcatttccggtgaacggcggcagcgtttctgtctgg
gtacaggaaacgggcgaaaactaa

DBGET integrated database retrieval system