KEGG   Baudoinia panamericana: BAUCODRAFT_34798Help
Entry
BAUCODRAFT_34798  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
Organism
bcom  Baudoinia panamericana
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 19112516
NCBI-ProteinID: XP_007676856
JGI: Bauco1_34798
UniProt: M2NA84
LinkDB All DBs
Position
Unknown
AA seq 1152 aa AA seqDB search
MAFLDKVFKNRRKSQQIVNGLSNGRSVNGTAANGTTTNGYGAATNGQPAYVPQKSATEAQ
GRYPDPPNHGEQRQTVGADLEAFTGLISHMMRPMPEQMGDGTYAKHEEAHSSLFSELSSL
GIKDYKTLADYVSAGTGPVDDKTMLMERVIQLVAKLPDKSAHRVELTNKFVDTLFNSLQH
PPLSYLGDQFKYRQADGSHNNIMYPHMGKANTPYARTVQSETVQPGALPDPGLVFDSLFA
REKFEPHPNNNSSIIFYWASIIIHDLFQTDHSDFNNSQTSSYLDLSPLYGDTQEDQDTIR
TFKDGKLKPDCFCEHRLLTFPPGCGVILIMFNRFHNNVAEQLAAINENNRFTKPSPNLSP
EQAQKAWAKYDNDLFQTARLVTGGLYMNITLIDYVRTIINLTRSNTTWTLDPRVKEADTL
FANDGTPRGIGNQVSAEFNLVYRWHSAVSERDDKWTQELFKEMWGKPAEQVSMPELMMGL
HHWEQTMPKDPFDREFNKMKRGPDGRYNDDELVEVITSSIEDVAGRFGANHIPKSLRAID
ILGMKQARAWELCSLNEFRKFFGLTPHRTFESINPDPKVAQQMRNLYEEPDRVELYTGLI
AEGAKQPMQSGGELSDVGVGICPTYTISRAILSDAVALVRGDRFYTIDYTPKNLTNWGYS
EVQYDFSVEQGCCFYKLFLRAFPNHFLPNSIYAHMPMTTPEENRKIMRVLGRESHYSWDR
PKRIPDRVVIQNYKGVRQILENGNVFKVINAEPFAYLYGPLSRSFMLTGDGKPFVENKQM
MHKALYRESWHQQVRDFYEFITLKLLREKSCEIAGLNQIDITRDVGNLAHVHFVANVFSL
PLKTHEHPRGVYTEHELYQVMAGQFVFLFFDIDPAKSFPLALLVRNVIQQLGQLVLANVK
WIQNTGFLSAVTERLHHEETPLSDYGTHMIQRLLATGKTAEEITYGNIMGTAGAMVANQA
QVFTQIVDYYMSPAGNKHWPEIQRIAREGFVGNNEDKLLRYAMEAIRLNGTFGGYREVAA
QMTIDDTNFQGYVDVKPGDKVFVSFVKASRDPSVFPNPDEVRLDRDMDSYIHYGKGPHEC
LGEDASKVALTAMLRTVARLDNLRPAPGPQGVLKKVDRPLGFYAYMTEDWGKYFPFPTTW
RLHYDGTVPSSY
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccttgacaaggtcttcaagaacaggagaaagagccaacagatagtgaacggt
ctctccaatgggcgaagtgtcaatggaacagctgccaatggcacaaccacgaacggttac
ggcgctgctacgaatggccaacctgcatacgtaccgcagaagtctgctacagaagcgcaa
ggcagatatcctgaccctccaaaccatggcgagcaaagacagaccgtaggagccgacctt
gaggcgttcacgggcctgatctctcatatgatgagacccatgcctgagcagatgggtgat
ggcacgtacgcaaagcacgaggaagctcattcaagcctgttctcggaactgtcgtcgctt
ggcatcaaagactacaagacacttgcggactatgtgtcggcaggtactgggccggttgat
gacaagaccatgcttatggagcgagtcatccagctcgtcgcaaagctcccggacaaatcg
gcgcatcgtgtcgagcttacgaacaagttcgtggacaccttgttcaacagcctacagcat
ccacctttgtcatacttaggagaccagttcaaatacagacaagcggacgggtctcacaac
aatatcatgtatccgcacatgggaaaggctaatacgccatacgccagaactgttcagtca
gaaactgtgcagccgggtgctttgccagatcccggtcttgtattcgacagcttgtttgcc
cgtgaaaagtttgagcctcatccgaacaacaacagcagcatcattttctactgggcatcg
atcatcattcatgacctgttccagacagatcatagcgacttcaacaactcgcagacctca
agctacctcgatctgtcaccgctctatggcgatacgcaagaggaccaagacactattcgt
actttcaaggatggcaagctgaagcctgactgcttctgcgagcatcgtctgctaaccttt
ccacctggctgtggcgtcatcctcatcatgttcaaccgcttccataacaacgtagccgaa
caacttgcagccatcaatgagaacaatcgcttcacgaagccgtcgccaaacctgtctcca
gaacaggcacagaaggcctgggctaagtacgacaacgatctgtttcagaccgctcgcctg
gtcaccggcggcttgtacatgaacatcacgcttatcgactacgttcgcaccatcatcaat
ctcaccagaagtaacacaacttggacacttgatccaagagtgaaggaggcggatactctc
ttcgcaaacgatggcacacctcgcggcattggcaaccaagtgagcgccgagttcaaccta
gtctatcgatggcacagtgctgtgagcgaaagagacgacaagtggacgcaagagctgttc
aaggagatgtggggcaagcccgcagagcaagtctctatgccggagcttatgatgggtctg
caccattgggagcagacgatgccaaaggatcccttcgatcgcgagttcaataagatgaag
cgtgggccagatggccgatacaacgacgatgaactggtcgaggtaatcacgtctagcatt
gaggacgtggcggggcgctttggcgcgaatcacatccccaagtccctccgcgctattgac
attctgggcatgaagcaagcaagagcctgggagctgtgttcgttgaacgagttccgcaag
tttttcggcttaacaccgcacaggacgtttgagagcatcaatcccgatccgaaggttgca
cagcaaatgcgcaacctgtacgaggagcccgaccgagttgagctttatactggacttatt
gcggagggtgctaagcagcccatgcagtccggtggcgagctcagcgatgttggggtcggt
atctgcccgacctacacaatctctcgcgctatcctttcggatgctgttgctcttgtgagg
ggcgaccgattctatacaatcgactatactcctaagaacttgacaaattggggctacagc
gaggtccaatacgatttctcagtcgagcagggttgctgcttctacaagctgttcttgcgc
gccttcccgaaccacttcctcccgaacagcatctatgcacacatgcctatgacgaccccg
gaggagaataggaagattatgagagtgcttggccgcgagtctcattacagctgggaccga
ccgaagcggatcccagatcgtgttgtgatccagaactacaaaggcgtccgtcaaatcctc
gagaacggcaacgtcttcaaggtcatcaacgccgagccattcgcctatttgtacggaccg
ctcagtcgctcgttcatgcttactggcgatggcaagccattcgtggagaacaagcagatg
atgcataaagctctctaccgcgagagctggcatcagcaggtcagggacttctacgagttc
atcacactgaagcttcttcgcgagaagagctgtgagatcgctggcctcaaccagatcgac
atcacgcgagacgttggtaatcttgcacacgtacatttcgtggcgaacgtcttctccctc
ccactgaagactcacgagcacccaagaggtgtctatacggagcatgagctctaccaggtt
atggcaggccagtttgtgttcctcttcttcgacatcgacccagccaaatccttcccatta
gctttactcgtccggaacgttatccagcaactcgggcagcttgtgcttgccaatgttaag
tggattcagaacactggtttcctgtccgcagtcaccgagagactccatcacgaagagacc
ccgctcagcgactacggcacccacatgattcaacgcctccttgcaacgggcaagacagct
gaggagataacatacggtaatatcatgggcacggcaggtgcaatggttgcgaaccaagcg
caagtgttcactcagatcgtcgactactacatgtcaccagccggtaacaagcactggcct
gagatccagcgaatcgcacgcgaaggcttcgtcggtaacaatgaggataagctgcttcgt
tacgccatggaagccatccgtctcaacggcacgttcggcggctaccgtgaagtcgcagct
cagatgacaatcgacgataccaatttccaaggctatgtggatgtaaagccaggtgataaa
gtctttgtctcgttcgtcaaagcctccagagatccttcggtcttcccgaacccggacgag
gtcagactcgaccgggacatggacagctacatccattacggcaaaggcccgcatgagtgc
ttgggcgaggacgcttcgaaggttgctctcactgcgatgctaaggactgtcgccaggctg
gacaacctacggccagcacctggaccgcaaggagtcttgaagaaggtggacagaccacta
ggcttctatgcatacatgaccgaagactggggaaagtacttccctttcccgacaacgtgg
cgtttgcactacgatggcaccgtcccaagtagctactag

DBGET integrated database retrieval system