KEGG   Baudoinia panamericana: BAUCODRAFT_63868Help
Entry
BAUCODRAFT_63868  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
Organism
bcom  Baudoinia panamericana
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 19116111
NCBI-ProteinID: XP_007672777
JGI: Bauco1_63868
UniProt: M2MTN7
LinkDB All DBs
Position
Unknown
AA seq 1239 aa AA seqDB search
MPQENKKRGRRMNKRKAEDEGSAIQQTSKRQKSNEDLNQQADFVPLQAQEESVDNAYPAA
EKPFFGMLDAEEQEHFKQAYEQLDPTSFGDLEDPDTFLTNVWKDAEGKELKIAQSQSCSR
LMERLIQLSTASQLKKLFQAFSGNFIHLVSHRFASHCCEALFLRAAPLVTEELIAPRLAD
GVNTKDTTALDEIYVSMENLFLHTLAEFEGSFGFLMTDSFASHALRVLLLVLSGEPTESA
SAKRLLQSKRKEGALMPGTGGTGGEAQEKTRTVPKAFGEKLEKVIADSIAGLDTDKLRAL
ATHPQANPTLQLLLKLELTQFGKERAKDERSVIRTLLPDEPITAESGSATFINGIIYDSV
GSHLVEQIVQHAPGKTFKSLYREFFKERLASFARNEVAGYVVCRLLERMSRDDLYDAHEV
LLPTLPNLLERNRTMVIATLIERCAVRDIDTTALAAELDRSVQCQDGFDVKKFLKVERAQ
PDGHTRTSETPHDSVQSSNDMDEVAAFVRPTEPAKVHFNLLAQAMLRVPGPMCGLILDSL
VQLDPPTLQQMAADSIVTRTMQAALTSKNASIIQKRKLIQLFYGHIGEMAVERSASHVVD
CIWEGTHGLAFIRERIAEELAENEGTIRESSYGRSVWKNWKMDMYKRRRAEWIKQSKFKA
SNDGFQSFSEIDSNKKQDETGGAVGKTPLELARERHLNKKREKEKQEKKEKKGKEKEGAT
LLSAVKDSVIQFIRAADDDASSKSSGHGLQQSGQGPRTVLVEHHPPKKLQQLLNVDLPVE
GQGKAGLLRTVEEVLHYSVNTWDQGFMDKLYSSITPVGLASDLLLSALNTNLHVYQVSPA
LTVIEKQTAKALATMFGFKGPFAGGVSQPGGSAANQSSIVVARNCLYPETKTKGYEGRSF
VLFTSAHGHYSLEKAAQMFGFGSEAVKSVSVDERGCMKADELERMIEQAKRDGETPFYVN
ATAGTTVLGSYDPLEQISDVCRKHGLWMHVDGSWGGPVIFSEKQRHKLQGVEKADSIAIC
PHKMMAVPVTCSFLLGKDLRQFHKGMTLPAGYLFHSNDVDEGSGVANGHHDQSAVDTDHP
HAHPNQEEDVKEFWDLADLTPQCGRRGDSLKLALSWIYYGTTGFGDMIDHAFSMAAYLAS
LVASNSNFTLVSDNPPPCLQVCFYFNGQEGVGHRNRNSKITEEITKRLIPRGFMIDYAPG
DEGKFFRVVVNVQTRKETVEGLVKAIQEVGDGLDVKTLG
NT seq 3720 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagagaacaagaagcgcgggcggcgcatgaacaagcgcaaggccgaagacgaa
ggctcggccatccaacagactagcaagcggcaaaagtccaacgaggatctcaaccagcaa
gccgactttgtccctcttcaggcgcaggaagaatcggtcgacaatgcgtatcctgcggct
gagaagcctttcttcggcatgcttgatgctgaggagcaggagcacttcaagcaggcctac
gaacagctcgaccctacttctttcggcgatctcgaggatccagacactttcctcaccaat
gtctggaaggatgccgaaggcaaagaactcaagatcgctcagagccagtcctgctcgcgg
ctcatggagcgcttgatccaactctctacggcgtcgcaattaaagaagctctttcaagca
ttcagcggaaatttcatccatctcgtctctcatcgttttgcgtcgcattgctgcgaagca
ctcttcctccgcgccgcccccttggtgacagaggagttgattgcaccccgactggcagac
ggcgtcaacaccaaggacaccactgcgcttgatgagatatatgtctccatggaaaacctg
ttcttacatacccttgcggaattcgagggcagctttggctttctcatgaccgactccttt
gcatctcacgccctgcgcgtcctgctccttgtgctgtctggtgagccaaccgagtcagcg
tctgccaagcgcttgctgcaaagtaagcggaaagaaggtgcgttgatgcctggcactggc
ggtactggcggagaggcacaggagaagactcgtaccgtaccaaaggcattcggtgagaaa
ctagaaaaggttattgccgacagcattgctggcctcgacaccgacaagctccgcgcactt
gcgactcaccctcaggcaaaccctaccctacaacttctgttaaagctcgagctcacccaa
ttcggcaaagaacgcgcgaaagacgagagatcagtgatccgcactctgctccctgacgag
ccaattacggccgagagcggtagtgcgacgttcatcaacggcatcatttacgactctgtc
ggttcacatctagtcgagcaaattgtacagcacgcgcccggaaagacgttcaagagcctg
tacagagagttcttcaaggaacgtcttgcgtcgtttgcccgcaacgaggttgctggctat
gtcgtctgccgtctgttagaacgcatgagccgggacgacttatacgatgctcatgaggtg
ctattaccgaccctaccgaatctgttggaacgcaaccgtacaatggtcattgcgacgctc
atcgaaaggtgcgccgttcgcgatatcgataccacggcactcgcagccgagttggacaga
agtgtccagtgtcaggacggtttcgatgtcaagaagttcctgaaggtggagcgagcgcag
ccggatggacatacaaggacgagcgaaacaccacatgacagcgtgcaaagtagcaatgat
atggacgaagttgctgcgtttgttcgccctacggagcctgccaaggtccatttcaacttg
ttggcgcaagccatgcttcgcgtgcctgggccgatgtgtggtctcatcctcgactctctg
gtccagcttgacccgcctactctgcagcagatggccgcagactcgatagtcacccgcacc
atgcaggcagcgctcacttcgaagaacgcatccattatccagaagcggaaactgatacag
ctcttctatggccatatcggcgaaatggcggtcgaaagatctgcatcgcacgtggtggac
tgcatctgggaaggcacgcacggcctggcgttcatccgcgagcgtatcgccgaagagctc
gcagaaaatgagggtacgatccgggagtccagctacggcaggagcgtgtggaagaactgg
aaaatggatatgtacaaacgcaggagagcggaatggataaagcagagcaaattcaaagcg
agcaatgacgggttccaaagcttctcggagatcgattcgaacaagaagcaggacgagacg
gggggagcggtcggcaagactccactagagctggcgagggagaggcatctgaataagaag
agggagaaggagaagcaagagaagaaggagaagaagggcaaggagaaggaaggcgcaacg
ctcctttccgccgtcaaagactccgttatccaattcattcgagccgcagacgacgacgcc
tcaagcaaatcatcaggccacggtctccagcaatccggccaaggaccccgaacagtactc
gtcgagcatcatccacccaaaaagctgcagcaactgctcaacgtcgacctaccggtagag
ggccaaggcaaagccggcctgctccgaaccgtggaggaagtcctccattacagcgtcaac
acttgggaccaaggcttcatggacaaactctactcctccatcacccccgtcggactggcg
tcagatctcttgctcagcgctttaaacacgaatctgcacgtctatcaagtttcgcccgcg
ctgaccgtgattgagaagcagaccgcgaaggcgttggcgactatgtttgggttcaagggt
ccttttgcgggtggtgtgagtcagccaggtggcagcgcggcgaaccagtctagcattgtc
gttgcacgcaactgcctttacccggagacgaagacgaaagggtatgaggggaggagcttc
gtgttgtttacgagtgcgcatgggcattacagtctggagaaggcggcgcagatgttcggg
tttgggtcggaggcggtcaagagtgtttccgtggacgagcgggggtgtatgaaggctgac
gagctggaacgaatgattgagcaggcaaagcgggacggcgaaacgccgttttacgtcaac
gcgaccgccgggacgacggttctcggctcgtacgatccactggagcagatctcggatgtg
tgtcggaagcatgggctctggatgcacgttgatgggtcgtggggcggaccggtgatcttc
agcgagaagcagcgacataagctgcagggggtagagaaggctgacagtatagcgatctgt
ccgcacaagatgatggctgtcccggtcacgtgctcgttcctgctagggaaggatttgcgg
cagtttcacaagggcatgacgctacctgcaggctatctcttccattcgaacgatgtggac
gaaggcagcggcgtagcaaacggccaccacgaccagagtgccgttgataccgatcacccg
cacgcccatccgaaccaagaggaggacgtgaaagagttctgggaccttgcggacctgacg
cctcaatgtggacgacgaggggacagtctcaaactcgcactttcctggatctactacggg
accaccggcttcggagacatgattgaccacgccttctcaatggccgcctaccttgcatcc
ctggttgcctcgaactctaacttcactttagtctcagacaatccaccgccgtgtttgcag
gtctgtttctacttcaacggacaagaaggtgtaggccaccgtaaccggaattcgaagatc
acggaagagatcactaaacgcttgataccgagaggatttatgatcgactacgctccgggt
gatgaaggcaagttcttcagggtggtggtgaatgtgcagacgcggaaggagacggtggag
ggtctcgtcaaggctatccaggaagtgggagacggtctggatgttaagactctggggtga

DBGET integrated database retrieval system