KEGG   Burkholderia contaminans: NL30_34870Help
Entry
NL30_34870        CDS       T03969                                 

Definition
(GenBank) AMP-binding protein
Organism
bcon  Burkholderia contaminans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(948484..950292)
Genome map
AA seq 602 aa AA seqDB search
MARAAVFLKGRILVTKCASTIHRLIESLEDVAGAMHRMTFVDDAGNEASITYRRFAEEVF
RQAGALRELGVRENDLVMLALPASVEHAAAMMACVMTGALPCTVPVPARRATAGRQVIDV
ACELYRPRLVIAADAQSAAWRDDAFPASSTRVVDLDTLSIVADAGARALISAKHGRDPHH
VQLTSGSTSHPKAAVLSHENVIANVLGIGGSVRFDIAAGDGTASWLPLYHDMGLLTLLSN
MHYRAPLLMMQPNSFIRHPLGWLKRIASARATTTSVPTFALRYCVRRFNAAAMEGVDLSA
CRNIFIGGERVDDATLRDFAATFAPYGLAASALQPCYGMAESTLAVSMHRAWHEGAVDGA
PYVIADTLDRRALIERRDAQPAAANDGADTDTDTETVLAMGTPIEGMAFRILDDGDHPLA
NRAVGEVAIRGTSVMLGYLNPDDGSIAAPLTADGWFRTGDIGYVADGQLHILGRKKEVII
IRGSNYFPHEIEEALASHRMLRKSTCIAFGLPDPETGTERLVVAIEARPVDATPQTRAEC
QQLLASRIGFAAQDLCFVEPGSLPRTTSGKLQRLKCRDLYANGALPVIHATAAAEAGQGA
YA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgagcggccgtgttcctcaaggggagaatcctcgtgacgaagtgcgcatccacc
attcaccgcctcatcgaatcgctcgaggacgtcgcgggcgccatgcatcgcatgacgttc
gtcgacgacgccggtaacgaggcgagcatcacgtaccggcgcttcgccgaagaggtgttt
cgccaggccggcgcactgcgcgaactcggtgtgcgcgagaacgacctggtgatgctggcg
ttgcccgcatcggtcgagcacgcggcggcgatgatggcctgcgtgatgacgggcgcactg
ccctgcaccgtgcccgttcccgcgcgccgcgccaccgccgggcggcaggtgatcgacgtc
gcatgcgagctgtaccggccgcgtctcgtcatcgccgcggatgcgcagtccgccgcgtgg
cgcgacgacgcgtttcccgcgtcatccacgcgtgtcgtcgatctcgacacgctgtcgatc
gtcgcggatgccggtgcgcgcgcgctgatcagcgccaagcatggccgcgatccgcatcac
gtccagctcacgtccggctcgacgtcgcatccgaaagccgcggtgctcagccacgagaac
gtgatcgcgaacgtgctcggcatcggcgggtcggtgcgcttcgacatcgcggccggcgac
ggcaccgcgtcgtggctgccgctctatcacgacatggggctgctcacgctgctgtcgaac
atgcattaccgcgcgccgctgctgatgatgcagccgaacagcttcattcgtcatccgctc
ggctggttgaagcgcatcgcgtcggcgcgcgcgacgacgacatcggtgccgaccttcgcg
ctgcgctactgcgtgcgccgtttcaatgccgccgcgatggaaggtgtcgatctgtccgcg
tgccgcaacatcttcatcggcggcgaacgcgtggacgacgcgacgctgcgcgacttcgcc
gcgacgttcgcgccgtacggtctcgcggcctcggcactgcagccgtgctacggcatggcc
gaatcgacgctcgcggtgtcgatgcatcgtgcgtggcacgaaggcgccgtcgacggtgcg
ccgtacgtgatcgccgacacgctcgaccggcgcgcgctgatcgagcgccgcgacgcgcaa
ccggccgccgcgaacgacggcgccgacaccgacaccgacaccgaaaccgtgctcgcgatg
ggcacgccgatcgagggcatggcgttccggatcctcgacgacggcgaccacccgctggcg
aaccgcgcggtcggcgaagtcgcgatccgcggcacgtcggtgatgctcggctacctgaac
cccgacgacggctcgatcgccgcgccgttgacggccgacggctggttccgcaccggcgac
atcggctacgtcgcggacggccagctgcatatcctcgggcgcaagaaggaagtcatcatc
attcgcggcagcaactacttcccgcacgaaatcgaggaggcgctggcatcccatcgcatg
ctgcgcaagagcacctgcatcgcgttcgggctgcccgatccggagacgggcaccgagcgg
ctggtcgtcgcgatcgaggcgcggcccgtcgatgcgacgccgcagacgcgcgccgaatgc
cagcagctgctcgcgtcgcggatcggcttcgccgcgcaggatctgtgcttcgtcgagccc
ggctcgctgccgcgcacgacgagcggcaagctgcagcgcctgaagtgccgcgacctctat
gcgaacggcgcgctgcccgtgatccacgcgacggccgccgccgaagccggccagggggcg
tacgcatga

DBGET integrated database retrieval system