Brucella canis ATCC 23365: BCAN_A1130 Help Entry BCAN_A1130        CDS       T00623                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bcs  Brucella canis ATCC 23365 Pathway bcs02024   Quorum sensing bcs03018   RNA degradation Brite KEGG Orthology (KO) [BR:bcs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BCAN_A1130 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BCAN_A1130 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bcs03019]     BCAN_A1130 (hfq)    03036 Chromosome and associated proteins [BR:bcs03036]     BCAN_A1130 (hfq) Messenger RNA biogenesis [BR:bcs03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BCAN_A1130 (hfq) Chromosome and associated proteins [BR:bcs03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BCAN_A1130 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  ABX62179 UniProt:  A9M5C4 LinkDB All DBs Position I:complement(1086869..1087105) Genome browser AA seq 78 aa AA seqDB search MAERSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFEGEEA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctgaacgatcgcaaaatctacaagacctctttctgaattctgtccgcaagcagaag atttctctaacgatcttccttatcaatggcgtgaaattgaccggcattgtaacgtctttc gataatttctgcgtgcttctgcgtcgtgatggtcattcgcagcttgtttacaagcatgct atttcgacaatcatgccgagccagcctgtacagatgtttgaaggcgaggaagcctga

DBGET integrated database retrieval system