KEGG   Burkholderia cepacia GG4: GEM_1005Help
Entry
GEM_1005          CDS       T02205                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00620  Pyruvate metabolism
bct00680  Methane metabolism
bct00710  Carbon fixation in photosynthetic organisms
bct01100  Metabolic pathways
bct01120  Microbial metabolism in diverse environments
bct01200  Carbon metabolism
Module
bct_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GEM_1005
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    GEM_1005
   00680 Methane metabolism
    GEM_1005
Enzymes [BR:bct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GEM_1005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFQ47452
UniProt: J7IZZ7
LinkDB All DBs
Position
1:complement(1100126..1103131)
Genome map
AA seq 1001 aa AA seqDB search
MKSSGSARTTRRNAALPSPDAQTGTIATAANGRAKTATKPKDPIRQTKRAAKTAGPAART
AGASKPGTRTREDKDGPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
SEAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AYALEQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQP
LTARERSYNESMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYGDIE
AALAEHGLSARVPAFFQMGSWIGGDRDGNPNVTAPTLEEAVNRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAAKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRAIPYADSEAFVADLKVLTASLDEHHGSSLAAPRLAPLVRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYLEYSA
LAQSELGVFEKAREVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGALGSHAK
SGLMVIPLFETIPDLRDAARIMREYFALPGVDALIAHQGDEQEVMLGYSDSNKDGGFLTS
NWELYRAELALVDLFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQ
GEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFETVMQTLSDAAMASYRA
LVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRL
LLTGWYGFGSAVSAYLDGAQDAAERTKRVTLLKKMNKTWPFFANLLSNMDMVLAKTDLAV
ASRYAQLVADRKLRKHVFERIVAEWERTSQALQEITGHEGRLATNPLLARSIKNRFPYLD
PLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacgacgcgccgcaatgctgccttgccctcccccgac
gcccagacgggcaccatcgccaccgccgcgaacggccgtgcgaaaacggcaacgaaaccg
aaagacccgatacgtcagacaaaacgcgcagccaagactgccggcccggcggcccgcacg
gccggcgcatcgaagcccggcacccgcacgcgcgaggacaaggacggcccgctgttcgag
gacatccgcttcctcggccgcctgctcggcgacgtggtgcgcgaacaggaaggcgacacc
gtgttcgacgtggtcgaaaccattcgccagacggcggtgaagtttcgccgcgaggacgac
agcgaggccgcacaaacgctggagaagaagctgcgcaagctgacgccggagcagacggtg
agcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgcggaagaccgccac
cacaaccgccgccgccgcatccacgcgctggccggctccgcgccgcagcccggcaccgtc
gcctacgcgctcgaacagctgaagaccaccggcaacgcgtcgaagcgcctgctgcagcgc
ttcttcgacgacgcgctgatcgttccggtgctgaccgcacacccgaccgaagtgcagcgc
aagagcatcctcgacgcgcagcacgacatcgcgcggctgctcgccgagcgcgaccagccg
ctgaccgcgcgcgaacgctcgtacaacgaatcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacccgcatgctgcgcgacgcgcgcctgacggtcggcgacgagatcgagaacgcg
ctgtcgtactaccgcgcgacgttcctcgacgagctgcccgcgctgtacggcgacatcgag
gccgcgctcgccgagcacggcctgtccgcacgcgtgcccgcgttcttccagatgggcagc
tggatcggcggcgatcgcgacggcaacccgaacgtgaccgccccgacgctcgaagaagcg
gtcaaccgccaggctgcggtgatcctcgaacactatctggaacaggtgcacaagctcggc
gccgagctgtcggtgtcgaacctgctggtcggcgcgaacgacgcggcgaaggcactcgcg
gccgcgtcgcccgaccagtcgccgcaccgcgtcgacgagccgtatcgccgtgcgctgatc
ggcatctacacgcgcctcgccgcgagcgcgcgcgtgcgtctcggcgaaggcacggtgccg
gtgcgcagcgcgggccgcggcgcgccgcccgtgcgggcgattccgtatgcggattccgaa
gcgttcgtcgccgacctgaaggtgctgaccgcgtcgctcgacgaacaccacggctcgtcg
ctcgccgcgccgcgcctcgcgccgctcgtgcgcgcggccgaagtgttcggcttccatctc
gcgagcatcgacctgcgccagagctccgacatccacgaagccgtggtcgccgagctgttc
gcgcgcgccggcgtcgaggccgactacgcggcgctcgccgaggaagacaagctgcgcgtg
ctgcttgccgcgcttgccgatccgcgcccgctgcgctcgccgtacctcgaatactcggcg
ctcgcgcagagcgagctcggcgtgttcgagaaagcccgcgaagtgcgcgcgcaattcggc
gcgcgcgcggtgcgcaactacatcatttcgcatacggaaaccgtcagcgacctcgtcgag
gtgctgctgctgcagaaggaaacgggcctgctcgaaggcgcgctcggcagccatgcgaag
agcggcctgatggtgatcccgctgttcgagacgatccccgacctgcgcgatgccgcgcgc
atcatgcgcgagtacttcgcactgccgggcgtcgacgcgctgatcgcccaccagggcgac
gagcaggaagtgatgctcggctactcggacagcaacaaggacggcggcttcctgacgtcg
aactgggagctgtatcgcgcggagctcgcgctcgtcgacctgttccgcgaacgcaagatc
acgctgcggctgttccacggccgcggcggcacggtcggccgcgggggcggcccgacctac
caggcgatcctgtcgcagccgccgggcaccgtgaacggccagatccgcctgaccgaacag
ggcgaggtgatcgcgagcaagttcgcgaaccccgagatcggccggcgcaacctcgagacg
gtggtcgccgcgacgctcgaggcgtcgctgctgccgcaatcgaacgcacccgcgcagctg
cccgcgttcgaaaccgtgatgcagacgctgtccgacgccgcgatggcgtcgtatcgcgcg
ctcgtctatgagacgcccggcttcaccgactacttcttctcgtcgacgccgatcaccgag
atcgccgagctgaacatcggcagccgtccggcctcgcgcaagctgcaggatccgaagaat
cgcaagatcgaggacctgcgcgcgattccgtggggcttctcgtggggtcagtgccggttg
ctgctgacgggctggtacggtttcggcagcgcggtgagcgcctatctcgacggcgcgcag
gacgcggccgaacgcacgaagcgcgtcacgctgctgaagaagatgaacaagacctggccg
ttcttcgcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgatctcgcggtc
gcgtcgcgctacgcgcagctggtcgccgaccgcaagctgcgcaagcacgtgttcgagcgg
atcgtcgcggaatgggagcgcacgtcgcaggcgctccaggaaatcaccgggcacgaaggc
cgcctcgcgaccaacccgctgctcgcgcgttcgatcaagaaccgcttcccgtacctcgat
ccgctgaaccacctgcaggtcgagctgatcaagcgtcaccgcgcgggcgacacgaacgca
cggctgcgccgcgggattcacctgaccatcaacgggatcgcggccggcctgcgcaacacg
ggctga

DBGET integrated database retrieval system