KEGG   Burkholderia cepacia GG4: GEM_1925Help
Entry
GEM_1925          CDS       T02205                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bct  Burkholderia cepacia GG4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GEM_1925
  Amino acid metabolism
   00310 Lysine degradation
    GEM_1925
   00380 Tryptophan metabolism
    GEM_1925
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GEM_1925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(2087028..2089892)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLNNPASVPENWREYFDALQNVPATDGSNAND
VAHFPIVESFAERAKANAFIPRESTSNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEGDLDQTYSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEFMYI
SDPEQKRWWQERLESTRATPAFSADKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKTGVQEIIIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLAIQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDTDGYVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAFASLVASGYSVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIIATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDAKKVKRVVACSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcctatctgttcggcggcaatgcttcg
tacgttgaagaactgtacgatgcatacctcaacaatccggcatcggtgccggagaactgg
cgagagtatttcgacgcgctgcagaacgtccctgcaaccgacggctcgaatgccaatgac
gtcgctcacttcccgatcgtcgaatcgttcgccgagcgtgcgaaggccaatgccttcatc
ccgcgcgaaagcaccagcaacctggcaaccgcgcgcaagcaggtccacgtccagtccctg
atcagcgcctatcgcttcctcggctcgcaatgggccaatctggatccgctgaagcgtcgc
gaacgtcccgccattcccgaactcgaacccgcgttctacgacttctccgaaggcgacctc
gaccagacgtacagcgcaagcaacctgtacttcggtttcgaccaggcttcgctgcgcgac
atcgtcaagggcctgcgtgacacgtactgcggcacgatcggcgccgagttcatgtacatc
agcgatccggaacagaagcgctggtggcaggagcgcctggaatcgacccgcgcgacgccg
gcgttctcggccgacaagaagaagcacatcctgaatcgcctgacggcagcggaaggcctc
gagcgctatctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggtggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcacgcaggcaagaccggcgtgcaggaa
atcatcatcggcatggcccaccgcggccgtctgaacgtgctggtcaacacgctcggcaag
atgccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggcaggc
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgaccgaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggttcg
gcgaaggcgcggatggatcgtcgcggcgacgaagacggcctgcaagtgctgccggtgcag
atccacggcgacgcggccttcgctggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgacgcgcgctcgacgctgtactgtaccgacgtggtcaag
atgatcgaagcgccggtgctgcacgtgaacggcgatgatccggaagccgtcgtgctcgcg
atccagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggtcacaacgagcaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgccgagaagctcgtgcag
cagggcgtgatcaccgcggaagacaccgacggctacgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacaccgtcgatccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggttccgttcctgaaccgcaagtggacggacgcagccgatacggccgtgccgctc
gccgaactgaagcgcctgggcgaacgcatcacgacggtcccggaaaacttcaaggttcac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgtggcgaccagccgctc
gactggggcatgggcgaacacctcgcgttcgcgtcgctcgtcgcatcgggctactcggtg
cgcctgacgggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgaa
ggtcaggcgaagttcacggtgatcgactcggtgctgtcggaagaggcggtgctgggcttc
gaatacggttactcgaccgccgagccgaacacgctcgtgctgtgggaagcccagttcggc
gacttcgtcaacggtgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggtctcacgatgctgctgccgcacggctacgaaggccagggtccg
gaacactcgtcgacccgtatcgagcgtttcctgcaactgtgcgctgaccacaacatgcag
gtcgttcagccgacgacgccggcacagattttccatctgctgcgtcgccagatgatccgc
ctgttccgcaagccgctgatcatcgccacgccgaagtcgctgctgcgccacaaggaagcg
gtgtcggacctgtcggaactcgcgaagggttcgttccagccggtgctgggcgaaaccgac
ggcggcatcgacgcgaagaaggtcaagcgcgtggttgcgtgctccggccgcgtgtactac
gacctcgtcgcgcaccgccgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgag
cagctgtatccgttcgcgcacaagcagttcgaagccgaaatgaagaagtacgagaacgcg
actgaagtggtctgggtgcaggacgagccgcagaaccagggtccctggttctacgtcgag
caccacctgaaggaaggcatgaaggaagggcagaagctggcatacagcggccgtccggct
tcggcctcgccggcggttggctactacgcgaagcactacgagcagcagaaggccctcatc
gaaggtgcgttcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system