KEGG   Burkholderia cepacia GG4: GEM_5604Help
Entry
GEM_5604          CDS       T02205                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bct  Burkholderia cepacia GG4
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GEM_5604
Enzymes [BR:bct01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GEM_5604
Transporters [BR:bct02000]
 Other Transporters
  Pores ion channels [TC:1]
   GEM_5604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:2668799..2669464
Genome map
AA seq 221 aa AA seqDB search
MQAMETTLKLFYYPGNASMAPHFVLEEIGKPFELAFVDRTRDQHKSPEYLALNPNGLIPV
LVDGDLVLYETAAICLHLADTHPEQRLAPALGTLERARFYKWLMWLTNTLQATLIAYFYP
ERWVDAGNAAGAAQVKAHAEEKVTTLLDLLEEQLDASGGPWLLGAHYTVLDPYALMLCRW
TRGFTEPARQRPRLSDYLQQVLARPAIQRALKTEGLAAPWV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgatggagacgacgttgaagctgttctactacccgggcaacgcaagcatggcg
ccccatttcgtgctggaagaaatcgggaagccgttcgagctggcgttcgtcgaccgcacg
cgcgaccagcacaagtcgcccgagtacctcgcactcaatccgaacggcctcattccggtg
ctggtcgacggtgacctggtgttgtacgagaccgccgcgatttgtctgcatctcgccgat
acgcatccggagcagcggcttgccccggcgctcggtacgctcgagcgagcccgcttctac
aagtggctgatgtggttgaccaacacgctgcaggcgacgttgatcgcgtatttctacccg
gagcgatgggtcgacgcgggcaacgcggcgggcgccgcgcaggtgaaggcgcatgcggaa
gagaaggtcaccacgctgctggatctgctcgaggaacagctcgacgcaagcggcggcccc
tggctgctcggtgcgcactacacggtgctcgatccgtatgcgttgatgctgtgtcgctgg
acgcggggcttcaccgagccggcgcgacaacgtccgcggctcagcgattatctgcagcag
gtactcgcgcgcccggcgatccagcgcgcattgaagacggaagggctcgcggcgccctgg
gtgtaa

DBGET integrated database retrieval system