KEGG   Bacillus cereus E33L: BCE33L0511Help
Entry
BCE33L0511        CDS       T00198                                 

Gene name
npr
Definition
(GenBank) bacillolysin (thermolysin-like metalloprotease, peptidase M4)
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bcz  Bacillus cereus E33L
Brite
Enzymes [BR:bcz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BCE33L0511 (npr)
Peptidases [BR:bcz01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BCE33L0511 (npr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AAU19730
UniProt: Q63G45
LinkDB All DBs
Structure
PDB: 

Jmol
Position
600932..602632
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFVSGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRLQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPVKQEAPK
QEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQDNTRGATIFTYDAKNRSTL
PGTLWGDADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSRY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTEYSSDLIYQNESGALNEAISD
VFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGTSDNGGV
HTNSGIINKQAYLLANGGTHYGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGANSAEVNAVKQSFSAVGIN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcttttgcagattctaaaaatgtgctctctacgaagaagtacaatgag
acagtgcagtcaccggagtttgtttctggggatttaactgaagcaactggtaagaaagcg
gaatctgttgtgtttgattacttaaatgcagcaaaaggtgattataagttaggggaaaag
agtgcacaagattctttcaaggtgaaacaagcgaagaaagatgctgtaactgattcaaca
gtattacgtttgcaacaagtatacgaaggagtacctgtatggggttctacgcaagtagct
cacgtaagtaaagatggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaagaaaagttgaaaaataaaaataagatcgaaggcgcaaaagcaattgaaattgcg
caaaaagatttaggggtaacacctaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaacggtgaagaaacaacatatgcatacgttgtaaatttaaacttcttagagcca
agcccaggaaactactactatttcattgaagcagacagcggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataagtcaccagttaagcaagaggcacctaaa
caagaagcgaaaccagctgtaaagcctgtaacaggcacaaatgcagtgggtactggtaaa
ggtgtattaggagatacgaagtcacttaatacaacgttatctgcatcatcttactattta
caagataatacgcgtggagcaacgattttcacatatgatgcgaaaaaccgctcaacatta
ccaggaacgttatggggagatgcggataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcactactatgcgggtaaaacatatgattactataaagctacatttaataga
aactctattaatgatgcaggagcgccattaaaatcaacagttcattatggaagtagatat
aataatgcgttctggaatggctctcaaatggtatacggagatggtgatggtgtaacattc
acttcattgtctggtggaattgatgtaattggccatgaattaacgcatgctgttacagag
tatagctcagatttaatctatcaaaatgaatcaggagcattaaatgaagctatttcggat
gtttttggtactttagtagaattctatgataaccgtaacccagattgggaaattggtgaa
gatatttatacgcctggtaaagcaggagatgcgcttcgctctatgagtgatccaacgaaa
tatggtgatccagatcattattctaagcgttacactggtactagtgataacggtggggtt
catacgaacagtggtattattaacaaacaagcttatttattagcaaatggtggtacacat
tacggtgtaactgtaactggtatcggtaaagataagctaggtgcaatttattaccgtgca
aacacacaatatttcacgcaatctactacatttagtcaagcgcgtgctggtgcagtacaa
gctgcagctgatttatatggtgcgaactctgctgaagtaaatgcagttaagcaatcattt
agtgctgttggtattaactaa

DBGET integrated database retrieval system