KEGG   Bacillus cereus E33L: BCE33L4639Help
Entry
BCE33L4639        CDS       T00198                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bcz  Bacillus cereus E33L
Brite
Enzymes [BR:bcz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BCE33L4639 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AAU15633
UniProt: Q632F5
LinkDB All DBs
Position
complement(4738817..4739356)
Genome map
AA seq 179 aa AA seqDB search
MKKRLFFSCCLLFLMAGCDQGKPKEIDVKLHNASGDEVGTAKVTQQTSGVKITIKGEGFA
PGPHGLHVHEIGECKAPRFESAGNHFNPDDKKHGLLNPKGAENGDLPNVIADGSGKIKAE
IDAPHITLEEGKTTIHRKDGASIIITENADDGMTQPTGKSGDRIACGVIVKKASDMKKK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacggctttttttcagttgttgtttactatttctgatggcaggttgtgaccaa
ggaaagccgaaagaaattgacgtgaaattacataatgcttcaggtgatgaagtggggact
gcgaaagtaactcagcaaacaagcggagtgaaaattacgattaaaggggaaggtttcgcg
ccaggcccgcacggactacatgtacacgaaattggagagtgtaaagcacctcgttttgaa
tcagctggaaatcattttaatccagatgataaaaagcatggactactcaatccgaagggt
gcagaaaacggtgatttaccgaacgtaattgcagacggttctgggaaaattaaagcagaa
atcgatgcaccgcatataacgcttgaagaaggaaaaacgacgattcatagaaaagatgga
gcgtctattattattacagaaaacgctgatgatggtatgacacaaccgacaggtaaatca
ggtgatcgaattgcttgtggtgtcattgtaaaaaaagcgtcggatatgaagaaaaagtaa

DBGET integrated database retrieval system