KEGG   Brachypodium distachyon: 100832905Help
Entry
100832905         CDS       T01717                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
bdi  Brachypodium distachyon
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100832905
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100832905
Chromosome [BR:bdi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100832905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 664 aa AA seqDB search
MERAANFIPGPNQELLDIKPLRSLAPMFPAPMGVNVNQSSTPPLVCVTPVGQFPTGFGAG
NLPAFGSFTTFNSTANGFSHAGTSTHGPIDATPISAYKTRSSVDGDQTSASERKAKRSAG
LAADGSNGVKVKRPKPIYKNLVAGKELAFLPESSGNPRGIVEAVHMTFEALRRRHLQMDE
TQEASRRADLKAGAIMMASNIRANMGKRVGTAPGVEIGDIFYFRMELCIIGLHAPSMGGI
DYMSAKFGNDEDSVAICIVAAGGYENEDDDPDTLVYSGSGGNSRNTEERHDQKLERGNLA
LERSLHRKNEIRVVRGFKDPACATGKIYIYDGLYKIQESWKERTKTGINCFKYRLQREPG
QPDGAAIWKMTQGWMQDAAARGRVILHDLSSGAEPIPVCLVNEVDHEKGPGHFTYANQVK
YLRPRSSMKPLQGCSCQSVCLPGDADCACGNHNGGDLPYSSLGLLVCRKPVIYECGETCH
CSLNCRNRVTQKGIKFHFEVFRTTNRGWGLRCWEPIRAGAFICEYVGEVIDELQVNLNDS
EDDYIFQTVCPGEKTLKWNFGPELIGEQSTYVSADEFVPLPIKISAKSMGNISRFMNHGC
SPNVFWQPVQYDHGDEKHPHIMFFALNHIPPMTELTYDYGVAAADPSHRTKNCLCGSSTC
RGVF
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggctgccaatttcatacctggccctaatcaggagctcctggatatcaagcca
ttgaggtctttagctccaatgttccctgcacccatgggagtcaacgttaaccagtcaagc
accccaccgttggtctgtgtgactccggttggccagtttcctacagggtttggtgctggg
aaccttcctgcttttggatcattcaccaccttcaattctactgcgaatgggttttcgcat
gcaggcaccagtactcatggtcccattgatgctacccctatctcagcatacaagacaaga
tcatctgtggatggtgatcagacttcggcatctgagcgcaaggctaagaggtcagctggt
ttggctgctgacggctcaaatggagttaaagtcaagcgccctaagcccatctacaagaat
ctagttgctggcaaggagcttgcgtttttgccagaatcatctgggaatcctagggggatt
gtggaagcagttcacatgaccttcgaggcactcagacggagacatctgcagatggatgaa
acacaagaggctagcagacgtgcagacctaaaagctggcgccatcatgatggccagtaat
atcagggccaatatgggaaagagggtaggaactgctcctggagttgaaataggggatatc
ttctatttcaggatggagctatgcatcattgggttgcatgctcctagcatgggtggcatc
gattacatgagtgctaaatttggaaatgatgaggattctgtagcaatatgtattgtcgct
gcaggtggttatgagaatgaggatgatgacccagatacactggtgtacagtggttcggga
ggtaatagtaggaatactgaggagaggcatgaccagaagcttgagaggggcaacctcgct
ctcgagaggagtttgcacaggaagaatgagatcagggttgtacggggcttcaaagatccg
gcttgcgcgactgggaaaatctatatatatgatggcctctataagatccaagaatcctgg
aaggagagaacgaaaactggcatcaattgcttcaagtacaggttgcagcgcgaacctgga
cagcctgatggagctgcaatatggaagatgactcagggatggatgcaagatgcagcagca
agaggcagggtcatactgcatgacctatcatctggggctgaaccaatcccagtttgtctc
gtcaatgaggtagatcatgagaaaggacctgggcatttcacctatgctaatcaagtcaaa
tacttgagaccccgtagttctatgaaacccttgcagggctgcagttgccagagtgtttgc
ctgcctggtgatgctgattgtgcttgtggaaaccataatggaggtgatttaccgtacagc
tcattgggactgttggtttgccgcaaaccagtaatatatgaatgcggcgaaacttgccat
tgctcccttaattgtcgtaatagagtgacccaaaaagggatcaagttccactttgaggtc
ttcaggaccacaaatcgaggctggggtcttcgctgctgggagcctatccgtgctggtgca
tttatttgtgagtatgttggtgaggtcattgacgagctgcaagttaatttgaacgatagt
gaagatgattacatttttcagactgtgtgtcctggtgagaagacgctaaaatggaatttt
gggcctgaattgataggtgagcaaagcacatatgtgtcagctgatgaatttgtgccattg
cccatcaagataagtgcaaaaagcatgggaaatatctcacgtttcatgaaccacggctgc
tccccaaatgtcttctggcaaccagtgcagtatgaccatggagatgagaagcacccacat
atcatgttctttgcacttaatcacatccctcccatgacagaattaacctatgactatggt
gtggctgcagccgatcccagtcatagaactaagaactgcctgtgtggatcatcaacctgt
cgtggagtgttttga

DBGET integrated database retrieval system