KEGG   Brachypodium distachyon: 100835449Help
Entry
100835449         CDS       T01717                                 

Definition
(RefSeq) thymidine kinase isoform X2
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00240  Pyrimidine metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100835449
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100835449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_30 AAA_14 VirC1 cobW
Motif
Other DBs
NCBI-GeneID: 100835449
NCBI-ProteinID: XP_003557737
UniProt: I1H4P3
LinkDB All DBs
Position
1
AA seq 279 aa AA seqDB search
MRSVCAMTALLSVCSSTSLRSSAFIPRAPFLSLPFRRDLSCSKLRLARSISTAAAAVKAR
AGGGRPLMEVRAAQSGEIHVIVGPMFAGKTTALIRRVQAEAATGRTVALIKSDKDNRYGL
DSAVTHDGTKMACWALPKLSSFQDKLGTEAYDKVDVIGIDEAQFFDDLYDFCCKAADHDG
KIVVVAGLDGDYKRNKFGSVLDIIPLADSVTKLTARCELCGHRAFFTLRKTQETRTEFIG
GADVYMPVCRQHYLDGQIVIEATRIVMEVERSTVTHALK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccgtttgcgccatgacggccctcctctccgtctgctcctccacctccctccgc
tcgagcgctttcattccgcgagcaccattcttgtcgctccctttccggcgggatctttct
tgctccaagctccgcttggcgaggtccatctctacagcagcggcggcagtcaaggctcgg
gcaggcggcggtcgaccgctgatggaggtccgggcagcgcagtccggggagattcacgtc
atcgtgggccccatgttcgccggcaagactaccgcgctcatccgccgcgtccaggccgag
gccgccaccggcaggactgtggcactcataaagtccgacaaagacaatcggtatggattg
gattctgctgtgacgcatgatggcacaaagatggcgtgctgggctctacccaagctttct
agctttcaagataaattaggaacagaggcttatgataaggtagatgtcataggaattgat
gaagcccaattctttgacgatctttatgatttctgctgcaaagctgctgatcatgatgga
aaaattgttgtggttgcaggcctagatggtgactacaaaaggaataagtttggctcagtt
ctggacatcattcccctggctgactcggtcaccaagctaaccgcacgctgtgagttgtgt
ggtcaccgggcgttcttcacattgaggaagacacaagaaactaggactgaatttattgga
ggagccgatgtgtatatgcctgtatgtaggcagcactacctggatgggcagattgttatc
gaggccacaaggattgttatggaagttgagagatccacagtgactcacgctttgaagtag

DBGET integrated database retrieval system