KEGG   Brachypodium distachyon: 100838090Help
Entry
100838090         CDS       T01717                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100838090
   00051 Fructose and mannose metabolism
    100838090
   00052 Galactose metabolism
    100838090
   00500 Starch and sucrose metabolism
    100838090
   00520 Amino sugar and nucleotide sugar metabolism
    100838090
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100838090
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100838090
Membrane trafficking [BR:bdi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100838090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 494 aa AA seqDB search
MRKAAAAAVAAAVAVGAALLVRRQIREAKRWARAAAVLRELEERCAATPARLRQVADAVA
VEMHAGLASEGGSKLGMIISHVESLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVK
QECEEISIPTNLMTGNSHDLFDFIAAALAKFVASEGEDFHLPEGRQRELGFTFSFPVKQS
SISSGTLIKWTKGFAINDTVGEDVVAELSRALDRQGLDMKVTALVNDTIGTLAGGRYDDN
DVVVAVILGTGTNAAYVERANAIPKWHGLLPKSGDMVINMEWGNFRSSHLPLTEFDQALD
AESLNPGEQIYEKLISGMYLGEIVRRILLKMTQEASLFGDDIPPKLKIPYILTTPHMSMM
HHDGSSDLRTVGAQLRDILGIQNTSLKTRRLVVAVCDIVAKRGSRLAAAGIHGILKKLGR
DIPSSDKQRTVIAMDGGLYEHYTIFSESLESTLQEILGEEVSSSVVIKLANDGSGIGAAL
LAAAHSQYLDAEEQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggcggcggctgcggcggtcgcggcggcggtggccgtgggggcggcgctgctg
gtgcgccgccagattcgcgaggcgaagcggtgggcgcgcgcggcggcggtgctgcgggag
ctggaggagcggtgcgcggcgacccccgcgcggctgcgccaggtggcggacgccgtggcc
gtggagatgcacgccgggctcgcctccgagggcgggagcaagctcgggatgatcatcagc
cacgtcgagtccctcccgtcagggcaagagaaggggctattttacgcacttgaccttgga
gggacaaatttccgtgttttacgtgttcaattaggaggaaaggaagggcgagttgtcaag
caagaatgcgaagagatttcaattccgacaaacttaatgacagggaattcacatgaccta
tttgactttatcgccgctgctttggcaaaatttgttgcctcagagggtgaagactttcat
ttgcccgagggaaggcaaagagaacttggttttactttctcttttccagtaaagcaatct
tcaatttcatctggtactcttatcaagtggactaagggttttgctattaatgacacggta
ggcgaggatgtcgtggctgaattaagcagggctctggaccgtcagggtctcgatatgaaa
gtcacagcactggtaaatgatactatagggacattggctggcgggagatatgatgacaat
gatgttgttgttgctgttatactgggtacaggtactaatgcagcatatgtggaacgtgcc
aatgcaattcctaaatggcatggcctcctgcccaagtcaggagatatggtaataaatatg
gaatgggggaactttaggtcatcccatcttcctttgactgaatttgatcaagcattagat
gccgaaagcctgaatcctggagaacagatttatgagaagctgatctctggtatgtatttg
ggggaaattgtaagaagaatcctgttaaagatgactcaagaagcttctctttttggtgat
gatataccaccaaaactaaagattccatacattcttacgacaccgcatatgtcaatgatg
catcatgacggatcatctgatctcagaacagttggagcccaactgagagatatcctaggg
atccaaaacacctcacttaaaacaagaagactagttgtggctgtatgcgatatcgttgca
aagcgtgggtcacgtctcgctgctgcagggatacacgggatcctcaaaaagcttggacgg
gatatccccagcagcgacaagcaaaggacggtgattgccatggacggtgggctctacgag
cactacacgatcttcagcgagtccctggagagcaccctgcaggagattctaggggaggaa
gtttcgtcctctgtcgtgatcaagcttgcgaatgacgggtcaggtattggggctgctctc
ctcgctgcggctcattctcagtaccttgatgctgaagagcaatag

DBGET integrated database retrieval system