KEGG   Brachypodium distachyon: 100844955Help
Entry
100844955         CDS       T01717                                 

Definition
(RefSeq) putative DNA ligase 4
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100844955
Enzymes [BR:bdi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100844955
DNA repair and recombination proteins [BR:bdi03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     100844955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 1239 aa AA seqDB search
MAATVRFGLLVAMFQAMSRDRTSAKKRGRLRAFLDRAYGAPGRDDYFSALRLVLPSLDRE
RGSYGLKEAALAAALVDALGIAKDSPDAVRLTNWRRGGGGSGRNAGNFSLVAAEVLQRRQ
GMTSGGLTIKEVNDALDHLSATENRSEKALVLSSLIKKTNALEMKWLLMIILKDLKLGIS
EKSIFHEFHPDAEDLFNVTCDLKLVCEKLNDRSQRHKRQDIEVGKAVRPQLAMRVSNASS
AWKKLHGKPVVAECKFDGDRIQIHKNGEEIHFFSRTFLDHSEYEPGMSRYIKENILVDRC
ILDGEMLVWDTALNRFAEFGSNQEIAKAARDGLETDRQLCYVAFDILYAGDTSVIHQSLT
ERHEILRKVVKPLKGHLEILVPTGGLNVHRPSDEPCWSIFAHNIEDAEKFFKETVDNREE
GIVLKDLDSKWEPGDRSGKWLKLKPDYIHAGTDLDVIIVGGYYGSGRRGGEVAQFLVGLA
VPSNDNSYPKRFLSFCRVGTGLSDEELDALVTKLKPHFRKNEYPKKPPRFYEVTNNSKER
PDVWIESPDKSVIISVTSDIRTIKSEVFAAPYCLRFPRIQQVRYDKPWHECLDVQSFVEI
VHSSNGTMQKAEDDKSLKNDNVKHTRTNKRGEKKNVSIIPSHLMKTDISGLKGETLIFAN
TMFYFVNTPPSYNLEYFHKVVVENGGSFSMNLNDSVTHCIAAEKKGIKYQAAIRHGRIIH
YSWILECCKQKCLLRLQPKYILFLADFARHKFLEEIDSYADFYYWDIDVADLKQIFSNMN
TITVDQSIVQRYKKKHCADERFCFFQGCCVYLHHAPLVNEDYNVISDLALKRVKHDLTMH
GGQVCSSLAPATHLVIVSVLQAYNFDISYKSFSPAERRYLHDKRLHVVSNKWLEDSVDKQ
MKLPEALYNLKPDTLEEIHIERSEVDVQPSNDKHEEDEEVEISHVTNARKRGRPSSSSSR
TVRAAPRPVRRTRARRGNQRAKIGDVESEESGPGETGQDDQKLKADYTSKMEEDNSDKDQ
RPPQAAPRPARRTSARRGNQLAKIDYLESEENDHGETGKADYTTKMEEDNLDKDQGPPPG
AQFITLEEQEPNGVKLSTGEDTTSSPRYKSKETSGRTNVAETTSTTGEKIEQMFDPVHAM
LLNMMPSLRQERRQDAITDPPATKLENNPPARAGSSTSSYRVPVPETVGSASNSGISASQ
TGSSTYSAGVPASDPNAAAPPKKKKVSYKDMANDLLKDW
NT seq 3720 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacggtgcgcttcgggctcctggtggcgatgttccaggccatgtcgcgggac
cgcacgtcggcgaagaagcggggccgcctccgcgcgttcctcgaccgcgcctacggggcc
ccgggccgggacgactacttcagcgcgctccgcctcgtcctcccgtcgctcgaccgcgag
cgcggctcctacgggctcaaggaggcggccctggccgcggcactcgtcgacgcgctcggc
atcgccaaggactcccccgacgccgtccgcctcaccaactggcgccgcggcggcggcggc
agcggccgcaacgccggcaacttctccctcgtcgccgccgaggtactgcagcggaggcaa
ggaatgacttctggcggcttgacgataaaggaggttaacgatgcactcgatcatctatct
gcaactgagaacaggtctgagaaggctttggttctttcaagtctgatcaagaaaaccaat
gcccttgaaatgaagtggcttctaatgattattcttaaggatttaaaactggggatcagt
gagaagagcatattccatgagtttcatcctgatgctgaagacttgttcaatgtcacttgt
gacttaaaattagtctgtgaaaagctcaatgatcgaagtcaaaggcataaacgacaggat
atagaagttggaaaggctgtcagacctcaactagctatgagagtcagtaacgcttcatcc
gcttggaagaagcttcatggcaaaccagtggtcgccgagtgcaaattcgatggggaccgt
atccaaattcacaagaatggggaagagatccatttcttctcacggacctttcttgatcac
tccgaatatgaacctgggatgtccagatatatcaaggaaaatatcctggttgacaggtgt
attttggatggagagatgcttgtttgggacacggcgcttaatcggtttgcagaatttggt
tcaaaccaggaaatagcgaaggccgcaagggatggactggaaactgatcgacagctgtgc
tatgttgcttttgacattctttatgctggagacacaagtgttattcaccaaagtttgaca
gagcggcatgaaattctgcggaaggttgtcaaacctttaaagggtcatcttgagattttg
gttccaacaggtggtctgaatgtccatcgtccttcagatgaaccatgctggtccattttt
gcacacaatattgaagacgcggagaaattcttcaaggaaactgttgataacagagaagag
ggaattgtactgaaggaccttgattccaaatgggagcctggtgatcgaagtggaaagtgg
cttaaattaaagcctgattatatacatgctggcactgatctggatgttattattgtaggt
ggatattatggatcaggacgtcgaggaggagaggttgcacagtttttagttggtctggca
gtgccttcaaatgataatagttatcccaaaagatttctttctttttgtcgagtcggtact
ggtctctctgacgaagaacttgacgctcttgtcacgaaactgaagccacacttcaggaaa
aatgagtaccccaagaaaccacccagattttatgaagtaacgaacaattcgaaggagcgg
ccagatgtttggatagaaagccctgataagtcagtcataatatctgtaacgagtgatatt
cgaacaatcaaatctgaggtatttgccgccccgtactgcttgaggttcccccgcattcag
caagtgagatatgataagccatggcatgagtgcctcgatgtgcagtcatttgtggagatt
gtgcattcaagtaatggcacaatgcagaaggcggaagatgataagagtctgaagaatgat
aatgtaaagcacacaagaacaaacaaaaggggtgagaagaagaatgtatcgatcatccct
tcacatcttatgaagactgacatatcaggcctaaagggagagaccctgatatttgcaaac
acaatgttctatttcgtcaacacccctccatcatataacctcgaatatttccataaagta
gttgtggagaatgggggttctttctcaatgaatctcaatgactcagttactcactgcatt
gcagccgagaaaaagggtatcaaatatcaggcagccatacgtcacgggaggatcattcac
tattcctggatcttggaatgttgcaagcaaaaatgtcttcttcgtttgcaacctaagtat
attctctttcttgcagattttgctaggcacaaatttcttgaagagatcgactcgtatgct
gacttttactactgggatatcgatgttgctgacctcaagcagattttcagcaacatgaac
acaattactgtcgatcagagcattgtacaacggtacaaaaagaagcattgtgcagatgaa
agattctgcttcttccagggttgctgcgtttacttacatcatgcacctttagtgaatgag
gactacaatgtaatatctgatcttgcactgaagagggtgaagcatgaccttaccatgcat
ggtggtcaggtctgcagcagccttgcccctgctactcatttggttatagtttcagttctg
caggcctacaattttgacatatcgtacaagagcttttctcctgctgagaggcgttatcta
catgacaaaagattgcatgttgtcagtaataagtggttagaagattcagtggataaacaa
atgaagctgcctgaagccctctacaaccttaaaccggatacattagaagaaatacatatt
gaaaggagcgaagtagatgtccagccctctaatgacaaacacgaggaagatgaggaggtc
gaaatatctcatgttacaaatgcaaggaaaaggggcaggccatccagtagtagttcacga
actgtaagggctgctcctaggccagtccgaagaacaagggctagaagaggaaaccagcgt
gcaaaaataggtgatgttgagtctgaagaaagtggccctggtgaaacaggtcaagatgat
caaaaattgaaagcagattacacctctaagatggaagaagataacagtgacaaagatcaa
agaccacctcaagctgctcctagaccagctcggagaacaagtgctagaagaggaaatcag
cttgcaaaaatagactaccttgaatctgaagaaaacgaccatggtgaaacaggcaaagca
gattacaccaccaagatggaagaagataacctggacaaagaccagggaccacctccaggt
gcccagtttatcacattggaggagcaagagcccaacggtgtcaaattgagtaccggggag
gatacaacaagcagtcctaggtacaaaagcaaagaaacttctggaagaacaaatgttgct
gaaacaaccagcacaacgggagaaaagatagaacaaatgtttgatccagtgcacgcgatg
cttctcaacatgatgccgtccctgcgccaggaaaggagacaagacgcaatcacggatccc
ccagcaaccaaacttgagaacaatcctccagcacgggcaggaagttccacatcgagttac
agggttccggtgccagagacggtaggctctgcgtctaattccgggatctcggcatcgcag
acagggagttcaacatacagtgcgggggttccagcttcagatccaaacgctgctgctcct
ccaaagaagaaaaaagtgagctacaaagatatggccaacgatctcctgaaagattggtga

DBGET integrated database retrieval system