KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_10435Help
Entry
EL88_10435        CDS       T03262                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bdo00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    EL88_10435
Enzymes [BR:bdo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     EL88_10435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2368348..2369670)
Genome map
AA seq 440 aa AA seqDB search
MENSKKVYVGMSADMIHPGHLNIIREAAKLGCVTVGVLTDAAIASYKRLPYLDYNQRSEI
VRSLKGVDNVVPQETLDYVPNLERLKPDFVVHGDDWMQGVQSNVRNRVIECLKQWGGKVV
DIAYTKGFSSSAENERLKEIGTTPEIRQKRLRRLINAKKIVRILESHNGLTGLIAENVSV
IVNGVKHEFDGMWSSSLTDSTSKGKPDIEAVDLTTRLHDLNDTLECTTKPVIFDGDTGGK
IEHFVFTVRTLERLGISAVIIEDKVGLKQNSLFGTDAVQIQDTIEGFCNKIRTGKNAQVS
DDFMIIARIESLIAGKSIDDALARAAAYVEAGADGIMIHSKNKSGDDIKEFCQRFRVANV
STPIVVVPTTYSHITETELASWGVNVVIYANHMLRSAYPSMVNCAKSILMHERSQEAVND
YCMPIKEILELIPGTKKTLK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatagtaagaaagtttatgtggggatgagtgcggatatgatacatcctggtcat
cttaatataatccgcgaagcggcaaaacttgggtgtgtaacagttggcgtgctgacagat
gctgctatagcaagttacaagcgtttaccttatcttgactataatcaacgatcagaaata
gttcgttccttgaaaggagtggataatgttgtccctcaagaaacattggattatgttcct
aatcttgagcggttgaagcctgattttgttgttcatggagatgactggatgcagggagtc
cagtccaatgttcgtaatcgggttatagaatgtctgaaacaatggggaggaaaagttgtc
gatatagcttataccaaaggcttttcttcttccgcagaaaatgaacgtctgaaagagata
ggaactactcctgaaatccgtcagaaacgtcttcgtcgtttaattaatgccaagaagata
gttcgcatattggaatcccataatggcttgaccggtttgatagcagaaaatgtatctgta
atcgttaatggcgttaagcatgaatttgacggtatgtggtcaagttcattgacagactct
actagtaaagggaagcctgacattgaagctgtagatttgaccacacgtttgcatgacttg
aacgacacgttggaatgtacaacgaaacctgtcatattcgatggagatacgggcggtaaa
attgaacattttgtattcacagttcgtaccttggagcgcttaggaatttctgctgtcatc
atagaagataaggtaggtttaaagcagaattctttgttcggtacagatgcggttcagatc
caagatactattgaaggattttgtaataagatccgtacaggaaaaaatgcacaagtgtcg
gacgattttatgataatagcccgtattgaaagcctgattgccggaaaaagtatagacgat
gcactggcgcgtgcggcggcgtatgtggaagcaggtgcagatggcattatgattcatagc
aagaataaaagtggggatgatattaaggaattttgtcaaagattccgggttgctaacgta
tctactcccattgttgtagtacctactacttacagtcacataacagaaaccgaattggct
tcatggggtgtgaacgtagtaatttatgcaaatcacatgttgcgaagtgcatacccctct
atggttaactgcgccaaatcaatccttatgcacgaacgctcacaggaagctgttaatgat
tactgtatgcctatcaaggagattttggaacttatacccggaacaaaaaaaacactaaaa
tga

DBGET integrated database retrieval system