KEGG   Betaproteobacteria bacterium GR16-43: BWI17_11510Help
Entry
BWI17_11510       CDS       T04726                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
beba  Betaproteobacteria bacterium GR16-43
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:beba00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BWI17_11510
Enzymes [BR:beba01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BWI17_11510
DNA repair and recombination proteins [BR:beba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BWI17_11510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2328961..2331705)
Genome map
AA seq 914 aa AA seqDB search
MAKDSLKEYGAKRTFTATPEPAPVLATGRGGPLLFVVQQHRASRLHYDFRLECDGVLKSW
AVPKGPSLDTNEKRLAVQTEDHPFGYASFEGVIPPGQYGAGEVIVWDCGVYSPDEGGTWY
HDREGAEREVLDGLAKGKLSFTLRGEKLKGSFALVKTKEAKQWLLIKHRDRFVTADDVTQ
RNRSVLSGIAVSEMKTVPAGKRLPAVQLVPNGEVVPMPAPAKLAPMLAESGDKPFNKPDW
MWEPKLDGYRVLAFIGEDGVKLRSRRGLDYAATFPALASELGKQQAVNGMVLDGEIVAFG
ADGRPSFGALQERAQLKTASEIAAADRDIPIVFFAFDMPWFAGIDLRAVPYRERRRYLAQ
CILPSPRVQLVHAVDDGLALHEAAIAAGFEGVIGKRKESRYEAGKRSQSWVKVKPTHTGD
FVIGGYTKGKGSRGDLGALIVGYWEGKSLRFASGVGSGFDDRTLAAVRARLKPLERKTMP
FSEKPELMNGGVPVWVEPEIVAEVEFQNWTDDGHLRAPVFLRLRDDLDAKKVKKPEFRVS
TLTDGNSTDNVLTLNSDPAIDLVVAQLEGKQKEMMLVVGKDRIKVTNLDRVYWPEDKALK
QPALTKRDLLRYFAGISPYILPHLRDRPLTMIRMPDGINGQRFFQKHWEQERPAFVEKIS
VFSGSKDEQHEYLLCNNLPTLLWLAQSGTLEFHVWHSRSNPGLDAKMQASDFDSSLEALE
SSVLNYPDYVVFDLDPYIYSGQEAKGAEPELNTVAFEKGKEVAFWLKELLNSMSLNPIVK
TSGKTGLHIFVPIKRTIDFDAARHVSELVGRHLMRQHPKDITLEWSIPKRTGKIFMDYNM
NVRGKTLNVAYSPRGAPGAPVSMPLTWEELANAHPLDFRLTNAVERLSQTGDRWHDALTI
KQSLERALKKSGSG
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagacagcctgaaggaatacggcgccaagcgcaccttcaccgcgacccccgag
cccgcaccggtcctggccacggggcgcggcggcccgctcctcttcgtcgtgcagcagcat
cgcgcgtcacggcttcactacgacttccgcctcgagtgcgacggcgtgctcaagtcgtgg
gccgtccccaagggaccgtccctcgacactaacgagaagcgcctcgccgtgcaaacggaa
gaccatccgtttggttacgcttccttcgagggcgtgatcccgcccggccagtacggcgcc
ggcgaggtgatcgtgtgggactgcggcgtgtactcgcccgacgaaggcggcacctggtac
cacgatcgcgaaggcgccgagcgcgaggtgctcgacgggctcgcgaaagggaagttgtcc
ttcacgctgcgtggggaaaaattgaaaggctccttcgccctcgtgaagacgaaggaagcc
aagcagtggctgctgatcaagcaccgggatcgtttcgtgacggcggacgacgtgacgcag
cgcaaccgctccgtgctctccggcatcgccgtgtccgagatgaagaccgtgcccgcgggc
aagcgcctgcccgccgtgcagctggttcccaatggcgaggtcgttcccatgccggccccc
gcgaagctcgcgccgatgctcgcggaatccggcgacaagcccttcaacaagcccgactgg
atgtgggagccgaagctcgacggctatcgcgtgctcgccttcatcggcgaggatggcgtg
aagctccgctcgcgccgcggtctcgactacgcagcgacctttcccgcgctcgcatccgag
ctcggcaagcagcaagcggtgaacggcatggtcctcgacggcgagatcgtcgcgttcggc
gccgacgggcgtccgtcgttcggtgcattgcaggaacgcgcgcaactgaagaccgcgagc
gagatcgccgcggccgatcgcgacatcccgatcgtgttcttcgcgttcgacatgccctgg
ttcgcgggcatcgacctgcgggccgtgccgtatcgcgagcgccgccgctatctcgcgcaa
tgcatcctgccctcgccgcgcgtgcagctcgtgcacgccgtggacgacggcctggccctc
cacgaggcggccatcgccgcgggcttcgagggcgtgatcggcaagcggaaggaaagccgc
tacgaggcgggcaagcgctcgcagtcgtgggtgaaggtgaagcccacgcacacgggcgac
ttcgtgattggcggttacaccaaaggcaagggttcgcgcggcgacctgggcgcgctcatc
gtcggttactgggagggcaagtcgctgcgcttcgcctcgggcgtgggctccggctttgat
gaccgcaccctcgctgccgtgcgtgcgcgcctcaagccgctcgaacgcaagacgatgccc
ttctccgagaaaccggagctgatgaacggcggagttccggtctgggtggagcctgagatc
gtggccgaagtcgaattccagaactggaccgacgacggccacctgcgcgcgcccgtcttc
ctccgcctgcgcgacgacctcgacgcgaaaaaagtcaagaagcccgagtttagggtcagc
acgttaactgacggaaattcgacagataacgtgctgaccctaaactccgatcctgcgatc
gatctcgttgtcgcgcagttggaggggaagcagaaggagatgatgctggtcgtcgggaag
gaccgcatcaaggtcaccaacctcgaccgcgtgtactggcccgaggacaaggcgctcaag
cagcccgcgcttaccaagcgcgacctcctgcgctacttcgcgggcatttcgccgtacatc
ctgccgcacctgcgcgaccggccgctcacgatgatccgcatgcccgacggcatcaacggc
cagcggttcttccagaaacattgggagcaggaacgccccgcgttcgtggaaaaaatcagc
gtgttctcggggagcaaggacgagcagcacgaatacctcttgtgcaacaacctgccgacg
ctgctgtggctcgcacagtcgggcacgctcgaattccacgtgtggcattcgcgttccaac
ccgggcctggacgcgaagatgcaggcctccgatttcgattcctcgctcgaggcgctggaa
agctccgtcctcaactatcccgactacgtcgtgttcgacctcgatccctacatctactcg
ggccaggaggcgaagggcgcggagcccgagctgaacacggtcgcgttcgagaagggcaag
gaggttgccttctggttgaaggagttgctgaactcgatgtcgctgaacccgatcgtcaag
acctcgggcaagacgggcctgcacatcttcgtgccgatcaagcggacgatcgacttcgat
gccgcgcgccatgtatcggagctggtcgggcggcacctcatgcgccagcacccgaaggac
atcacgctcgaatggagcattcccaagcgtaccggcaagatcttcatggactacaacatg
aacgttcgcggcaagacgctgaacgtcgcctactccccgcgcggcgctccgggtgcgccg
gtctcgatgccgctcacctgggaagaactcgccaacgcgcatccgctcgacttccgcctc
accaacgcggtcgaacgcctctcgcagaccggcgaccggtggcacgacgccctcaccatc
aagcaaagcctcgagcgagcgttgaagaaatcggggtcagggtag

DBGET integrated database retrieval system