KEGG   Theileria equi: BEWA_052440Help
Entry
BEWA_052440       CDS       T02820                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, putative
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
beq  Theileria equi
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:beq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BEWA_052440
Enzymes [BR:beq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BEWA_052440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
4
AA seq 614 aa AA seqDB search
MGRKCRNLIGICSGAIAGSYLFVKREHEKCSLPRDTKFIIPDKLKSRSDMIKSLKSDKFD
VLVIGGGCTGTSVALDCATRGLKCALVEANDFSSGTTSKSTKLLHGGIRYLESALLHLDL
KELQFVWKALEERAHLIGTAPFANSPVPIVMPIYQLWQLPYFWINIKIYEVLARFFCCNE
TRIPSSFFSGKSNAVFNFPGIRPDGLLGAVVYYDGQHNDSRTNVLMALTSTIDEYVPGQV
GSTIGNYLKVEELLKDSTGKVNGALVCDVLTGETFTVKADVVVNCAGPFAEKIKKLSLPE
SKLNILHSRGTHVTLPAKYCPTPYGLIIPKTSDGRVLFILPWQGNTIVGTTDNKDELQAN
PLPQVQDVDFICKDASKYMNCDASQIKADIKSTWSGLRPLLKGVDEVNQTGKLSRGHVIE
VDESGLVNVYGGKWTICRLMAQECVDKVVKHFPSVTKGSYACRTRNMVLLGTHNKEGVSD
IDDIKPRFNRLSSVITEKYGLDSTVSNHLVESYGYKALDVCELSKEMGLLKPIHEEHPYI
MGEVVYGIRNEMACKPIDILARRTRLAFKDVHAAVSSLGLVCDLMGKELSWSAETREQLH
KEATAYLKDMMVPS
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggaagtgccgaaatttgattggcatttgttccggagccatagctggttcctat
ttgtttgtaaaaagagaacatgaaaaatgctctctccctagggatactaaatttattatc
ccagataaacttaaaagcagaagtgatatgattaaaagtttgaagagtgataaatttgat
gttctcgttatcggaggtggatgtacaggaacatctgtggctctggattgcgctaccaga
ggtttaaaatgcgctttggtggaagcgaatgatttttcttctggaacaacttcaaagagc
acgaagctacttcatggtggtatcagatatctggagagcgctcttttgcatttggattta
aaggaacttcaatttgtttggaaggcattagaagaaagggcgcacttgattggtactgcg
ccgtttgcgaattctcctgttcctattgtaatgcctatatatcaattgtggcagcttcca
tacttttggatcaatattaagatctatgaagttctggctcgcttcttctgctgcaatgaa
acaaggattccttcctctttcttttctggaaaatcgaatgctgtcttcaattttcctgga
ataaggccagatggtctcttgggtgcagttgtgtattatgatggacagcataatgactct
cgtaccaacgttttgatggctttgactagtacgattgatgaatatgtcccaggtcaagtc
ggttctactataggaaactacttgaaagttgaagaattgctaaaggacagtacaggaaaa
gttaatggagccttggtgtgtgacgttcttactggtgaaactttcactgtaaaggctgat
gtagttgtcaactgcgctggcccgtttgctgaaaaaattaaaaaattgagcttacctgag
agtaaattgaacattttgcattcaagaggaacacatgttacccttcctgctaaatactgc
cctactccatacggacttattattccgaaaaccagcgatggaagagtactttttatcctt
ccatggcaaggcaatactattgttggaacaactgataataaagatgaattgcaggctaat
cctttgccgcaggttcaggacgttgattttatatgcaaggatgcttcaaagtacatgaat
tgcgacgccagtcaaataaaggctgatattaaatccacatggtctggtcttagacctctc
ctgaagggtgttgatgaagttaatcaaacaggaaaactgtctcgtggccacgttattgaa
gttgatgaaagtggacttgttaacgtgtacggtggaaaatggacaatttgcagactaatg
gcacaggaatgtgtagacaaggttgttaagcactttcctagtgttacaaaggggagctat
gcatgccgaactcgtaatatggtattacttggaacacataataaagaaggtgtatcagat
atcgatgacataaaaccaagatttaataggttgagttctgttataacggagaaatatggt
ttggattcaacagtatctaatcatttggtagaaagctacggttacaaggcattggatgta
tgtgagttatccaaagagatgggtttactcaagcctattcatgaagaacatccttacatc
atgggtgaggtagtttatggtatcagaaacgaaatggcatgcaaaccaatagacattttg
gccagaagaaccagattggcattcaaggacgtacacgcggcagtttcatccctcggcttg
gtctgtgacctgatgggaaaagaactttcatggtctgcagagactagagaacagttacac
aaggaggccacagcatatctaaaggacatgatggtcccaagttaa

DBGET integrated database retrieval system