KEGG   Bdellovibrio exovorus: A11Q_2385Help
Entry
A11Q_2385         CDS       T02492                                 

Definition
(GenBank) hypothetical protein
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
bex  Bdellovibrio exovorus
Brite
Enzymes [BR:bex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     A11Q_2385
Peptidases [BR:bex01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   A11Q_2385
Exosome [BR:bex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A11Q_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2434601..2435446
Genome map
AA seq 281 aa AA seqDB search
MFCNRSNVKYKNQYKTNQVQRGTRMSQKLLAIIMTATLSIAAHADFNQQVVGGVVAERGE
FPFQVSLQRTNGSHFCGGSLIKPNWVLTAAHCVGNSNMQVVAGLHDQKDRTGTETFSVKR
IIPHPKYNRSTLAYDFALIELNGESTFRTADLNHSEIEIPEIGQDPINVITSGWGTTKEG
AYTLPDLLQKVEVPLVSAKECNASASYNGRITDSMICAGLPQGGKDACQGDSGGPLFTKS
ASGDFSLVGVVSWGAGCARPNKFGVYSKVNAVIDWIATETQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgttctgtaatagatccaacgttaaatacaaaaaccaatacaaaacaaaccaagttcag
agggggacaaggatgtcacaaaaactattggccatcattatgacggcaacattatcaatc
gcagctcacgctgattttaaccaacaagtagtaggcggagttgtagcggaaagaggggaa
tttccgttccaagtttcattacaacgtacaaatggttcacatttttgcggtggttcttta
attaagcctaactgggtattaactgcagctcactgtgtgggtaacagcaacatgcaagtt
gtagctggtttacacgatcaaaaagatcgcactggtactgagactttttctgtaaaaaga
attattcctcatccaaaatataaccgcagcactttagcttacgacttcgcgttgatcgag
ctaaatggtgaatcaactttcagaactgctgatttgaatcacagcgaaatcgaaattcct
gaaatcggtcaagatccaatcaacgtgatcacaagcggctggggcacaacaaaagaaggt
gcttacacattgcctgatctattacaaaaagttgaagttccacttgtatcagcgaaagag
tgtaatgcgtccgcttcctataacggccgtatcactgacagcatgatctgtgcaggtctt
ccacaaggtggtaaagacgcttgccaaggtgactctggtggaccacttttcacaaaaagc
gctagcggtgatttctcattagttggtgttgtgagctggggtgctggttgcgctcgtcca
aataaattcggtgtttactcaaaagtaaacgcagtaatcgactggattgcgacagaaact
caatag

DBGET integrated database retrieval system