KEGG   Bacteroides fragilis 638R: BF638R_1728Help
Entry
BF638R_1728       CDS       T01691                                 

Gene name
nanH
Definition
(GenBank) neuraminidase precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BF638R_1728 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BF638R_1728 (nanH)
Enzymes [BR:bfg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BF638R_1728 (nanH)
Bacterial toxins [BR:bfg02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BF638R_1728 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2027223..2028857
Genome map
AA seq 544 aa AA seqDB search
MKKAVILFSLFCFLCAIPVVQAADTIFVRETRIPILIERQDNVLFYLRLDAKESQTLNDV
VLNLGEGVNLSEIQSIKLYYGGTEALQDSGKKRFAPVGYISSNTPGKTLAANPSYSIKKS
EVTNPGNQVVLKGDQKLFPGINYFWISLQMKPGTSLTSKVTADMASITLDGKKALLDVVS
ENGIEHRMGVGVRHAGDDNSAAFRIPGLVTTNKGTLLGVYDVRYNSSVDLQEHVDVGLSR
STDGGKTWEKMRLPLAFGEFGGLPAGQNGVGDPSILVDTKTNNVWVVAAWTHGMGNQRAW
WSSHPGMDMNHTAQLVLAKSTDDGKTWSAPINITEQVKDPSWYFLLQGPGRGITMSDGTL
VFPTQFIDSTRVPNAGIMYSKDGGKNWKMHNYARTNTTEAQVAEVEPGVLMLNMRDNRGG
SRAVAITKDLGKTWTEHESSRKALPESVCMASLISVKAKDNVLGKDLLIFSNPNTTKGRY
NTTIKISLDGGVTWSPEHQLLLDEGNNWGYSCLSMIDKETIGILYESSVAHMTFQAVKLK
DIIK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagccgtaattctattttcgcttttctgttttctgtgtgctataccggtagtt
caagcagcagataccatttttgttcgtgaaacacgtattcctattttgatagaaaggcag
gataatgtcttattctatctccgtttggatgctaaagagagccagaccctgaacgatgta
gtgttaaacttgggtgaaggagtgaatctttctgaaattcagtccataaagctttattat
ggaggtactgaagcattgcaggatagtggtaaaaaacgttttgctcctgttggatatatt
tccagtaacactccggggaaaacacttgccgccaatccgtcttattcaatcaaaaaatcg
gaggtaactaatcccggtaatcaggttgttctgaaaggagatcagaaactgtttcccgga
atcaattatttctggattagtttgcaaatgaagccgggcacttcgcttaccagcaaggtg
accgcggatatggcttcaattactttggatggcaaaaaagccctgttggatgtagtttca
gaaaatgggatagaacaccgtatgggagtaggagtgcgccatgccggagacgataattct
gccgcattccgtattccgggattggtgactactaataaaggtacgttactgggagtttat
gatgtacgttataacagtagtgttgacttgcaggagcatgttgatgttggtttaagtcgc
agtacagatggtggaaaaacttgggaaaaaatgcgtttgcctttggcttttggagaattc
ggtggtttgcctgccggtcagaatggggtaggagacccttctatccttgttgatacaaaa
acaaataatgtttgggtggttgctgcctggacacatggtatgggtaatcagcgggcatgg
tggagttcgcatccgggtatggatatgaaccatacagcacaacttgttttagctaaaagt
acagatgatggtaaaacatggtctgcacctattaatattacagagcaggtgaaagatcct
tcttggtatttcttgttgcagggaccgggtaggggtatcactatgagtgacggtactttg
gtattcccaactcagtttatcgattcgacacgtgtgcccaatgccggtattatgtacagt
aaagatggtggcaagaactggaagatgcacaattatgcacgtacgaacactacagaagcc
caggtagctgaggtcgaacccggagtgttgatgttgaatatgcgtgataatcgtggagga
agccgcgctgtggctattacaaaagatttgggtaaaacatggacggaacatgaatcttct
cgtaaggcattgccggaatctgtttgtatggctagtttgatcagtgtgaaagcaaaagat
aatgtgttgggcaaggatttattgattttctctaatcctaatacgacaaaaggacgctat
aatactactattaaaataagtttggatggcggtgtgacttggtcacccgaacatcagctg
ttgttggatgaaggcaataactggggttattcttgcctctctatgattgataaagagacg
attggtattctttatgaaagtagtgtggcgcacatgacattccaggctgtgaagttgaaa
gacattattaaatga

DBGET integrated database retrieval system