KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl602Help
Entry
Bfl602            CDS       T00138                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfl602 (pfkA)
   00030 Pentose phosphate pathway
    Bfl602 (pfkA)
   00051 Fructose and mannose metabolism
    Bfl602 (pfkA)
   00052 Galactose metabolism
    Bfl602 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Bfl602 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Bfl602 (pfkA)
Enzymes [BR:bfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bfl602 (pfkA)
Protein phosphatases and associated proteins [BR:bfl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bfl602 (pfkA)
Messenger RNA biogenesis [BR:bfl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Bfl602 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(670114..671076)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRGVVRAGLSEGIEVYGIYDGYLGLFQNRMMLLSYCSVSD
IINKGGTVLGSSRFPELKKDMIRSVVMNNISKSHLDALVIIGGDGSYIGARRLSDLGCPC
IGIPGTIDNDVAGTDYTIGYFTALETIIEAIDRLRDTSSSHQRISIVEVMGRYCGDLTIS
AAIAGGCEFVIIPELKFQMQDLVDKIKLNISKGKKHAIVAITERICNVFDLAQYIENETG
KETRATVLGHIQRGGKPVAYDRILASRMGAYSIELLLKGYGRHCIGIENEKLVHHDINDA
TKYMRRSFRQDLLTTAKKLC
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaaaataggagtgttaacaagtggtggtgattctccaggaatgaatgcggct
attcgaggagtagttcgggctggtttatctgaaggaatagaagtatatggaatatatgat
ggttatttagggttgtttcagaatcgtatgatgttattgagttattgtagtgtgtcagat
ataattaataaaggtggaacagttttaggatcttctcgttttcctgaattaaaaaaagat
atgattagatctgtagtaatgaataatataagtaagagtcatcttgatgctttagtgata
attggaggagatggatcttatataggagcaagacggttaagtgatttgggttgtccttgt
attgggattccgggtacaattgataatgatgtagctggaacagattatactattggttat
tttacagcattggaaactattattgaggcaattgatcgattaagagatacttcttcatct
catcaacgtatttctattgtagaggtaatgggtcgttattgtggtgatttaactatatct
gccgctatagcaggtggttgtgagtttgttattattccagaattaaagtttcaaatgcaa
gatttagtagataaaattaagttaaatatttctaaaggaaaaaaacatgctatagttgct
ataactgagcgtatttgtaatgtttttgatttagctcagtatattgaaaatgaaactgga
aaagaaacccgggctactgttttaggtcatattcaacgtgggggaaagccagttgcatat
gataggattttggcatctagaatgggggcgtattctattgagttgttgttaaaaggttat
ggtagacattgtattggtatagaaaatgaaaagttagttcatcatgatattaatgatgct
acaaagtatatgcgtcgttcatttcggcaagatctattaacaacggctaaaaagttgtgt
taa

DBGET integrated database retrieval system