KEGG   Paraburkholderia fungorum: OI25_6152Help
Entry
OI25_6152         CDS       T03799                                 

Definition
(GenBank) ribulose bisphosphate carboxylase large chain, catalytic domain protein
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bfn  Paraburkholderia fungorum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OI25_6152
Enzymes [BR:bfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OI25_6152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:2428715..2430013
Genome map
AA seq 432 aa AA seqDB search
MNTILQAQTVTDECLEADYLIETPLDPARVADVMAGEQSSGTFVRVANESDALRARSRAS
VVRIDELEPASQPSLPSAWLARQGTPGPWRRARVTLSFPLANIGVNLPTLAATVAGNLYD
LGEVTGMRLLSLRLPASYRARFELPRHGVAGTRALTQVADRPMIGTIIKPNVGLGAEETA
ALVRELCEAGIDFIKDDEVCANPAHAPLAERVRAVMKAVRDYRERSGRPVMVAFNITDDL
DAMRRHAELVEQEGGSCVMASINWCGFSAIQTLRRATPLVLHAHRNGFGMMSRDPALGMS
FQAYQTLWRLTGVDHMHVHGLAGKFAQSDAEVIESARDCATPLAPGCDDAVLPAFSSGQW
AGTVPATFDAVHSTDVLFMSGGGVLAHPDGPAAGVISVRQAWEAARAHTPLERYAERRPE
LRRALEFFGSRA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgatattgcaggcgcagaccgtcaccgacgagtgcctcgaagccgactatctg
atcgagacgccgctcgatcccgcgcgcgtggccgacgtgatggccggcgagcagtcgagc
ggcaccttcgtgcgggtcgcgaatgaatccgacgcgctgcgtgcgcgcagtcgcgccagc
gtggtgcgaatcgacgagctcgaaccggcttcgcagcccagcttaccgagcgcatggctg
gcgcgtcagggcacgccggggccgtggcggcgcgctcgcgtcacgttgtcgtttccgttg
gccaacatcggcgtgaatctgccgacgcttgccgcgaccgttgccggcaatctgtatgac
cttggtgaagtcaccggcatgcggctgttgtcgctgcgcttgccggcctcatatcgtgcg
cgctttgaattgccgcgtcatggcgtagccggtacgcgggcgctgacgcaagtcgcggac
aggccgatgatcggcaccatcatcaagccgaacgttggtttaggtgccgaagaaactgcg
gcgctggtgcgcgagttgtgcgaagcgggtatcgatttcatcaaggatgacgaagtgtgc
gcgaatcccgcgcatgctccgcttgctgagcgcgtgcgcgcggtgatgaaagcagtgcgc
gactatcgcgagcgcagcggccgccccgtcatggtcgcgttcaatatcaccgacgacctc
gacgcgatgcgccgtcacgcggaactcgtcgagcaggaaggcggcagttgcgtgatggcc
agcatcaactggtgcggcttttcggcgatccagacactgcgccgcgcaacgccactcgtg
ctgcacgcgcatcgaaacggtttcggcatgatgtcgcgcgatccagcgctcggtatgtcg
tttcaggcgtatcagacgctctggcgattgacgggtgtcgatcatatgcacgtgcacggt
ctcgccggcaaattcgcgcaaagcgacgccgaggtgatcgaatccgcgcgcgattgtgct
acgccactcgcacctggttgcgacgatgccgtgttgcccgcattctcgtcaggacaatgg
gcgggtaccgtgccggcgacgttcgatgccgtgcattccaccgacgtattgttcatgtcg
ggcggtggcgttctcgcgcatcccgacggtcctgcggccggcgtcattagtgttcggcag
gcatgggaggcggcgcgggcacacacgccgctggaacgttacgccgagcgcaggccggaa
ctgcggcgtgcgctggagttcttcggcagccgggcatga

DBGET integrated database retrieval system