KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_100190Help
Entry
BRAFLDRAFT_100190 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRAFLDRAFT_100190
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    BRAFLDRAFT_100190
   00982 Drug metabolism - cytochrome P450
    BRAFLDRAFT_100190
   00983 Drug metabolism - other enzymes
    BRAFLDRAFT_100190
Enzymes [BR:bfo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRAFLDRAFT_100190
Transporters [BR:bfo02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRAFLDRAFT_100190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 239 aa AA seqDB search
MPSERAMKTGSACPPPPGPGKLRLYSMRFCPYAQRTRLFLAAKGIEFETININLKDKPEW
LFEKAPLGKVPVLEKDGKIVYESLVCNEYLDGIYPDKCVTPSDPLEKARQSMILALWDAK
VIGFYYKLMTGKEDERPALGKQFLDGLQFIEKALTQPFFSGNKAGALDYNLWPWFERLCM
LKPIGVELSVDKFPQLTAWMERMLQLPEVKTCYFSPEAHAQFGKSWMAGSPDYDIGLEE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaaagggctatgaagacagggtccgcctgcccccctccccccggaccaggt
aaactccgtctgtacagtatgaggttctgtccgtacgcacagcggactcgcctgttcctc
gctgccaagggaatagagttcgaaaccatcaatatcaacttgaaggacaagccagaatgg
ctcttcgagaaggccccactaggcaaggtccctgtgttggagaaggatgggaagattgtg
tacgagtctctggtctgtaacgagtacctagatgggatctaccccgacaaatgtgtcact
cccagcgaccctttggagaaggcacgtcagagcatgattctggctctgtgggacgcgaag
gtgattggtttctactacaagttgatgacggggaaggaagacgagcgcccagccctgggc
aagcagttcctcgacggcctccagttcatcgagaaagccctgacacaaccgttcttctcc
ggaaacaaggccggtgcgctggactacaacctgtggccgtggttcgagcgactctgtatg
ctgaaacccatcggtgtggagctctccgtggacaagtttcctcaacttaccgcctggatg
gagcgcatgctgcagctgcctgaagtcaagacctgctacttctcaccggaggctcatgcc
cagttcggtaaatcctggatggcaggcagtcctgactacgacattggattggaggaataa

DBGET integrated database retrieval system