KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_117980Help
Entry
BRAFLDRAFT_117980 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    BRAFLDRAFT_117980
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    BRAFLDRAFT_117980
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BRAFLDRAFT_117980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 338 aa AA seqDB search
MAVQQVFCTIIFVVTILSNASAQDSMPSPRRQPKWCPVEVQEVKPYRVRSGSRTECRRAC
TWNRFCCEFNIIPVYTTAYRQVSRQEWKCCDDTVPCPDKTVSVDTPYKGIQLFADEYPVP
PLPYEYDALEPYIDERTARVHHLGHHAGYTKKMNAALKAWRDEVGPGVGLQSNSILHILE
NLNQVPDKHRTAIRNNGGGFVNHAIYWATMSPRREGEPPRLPEATLATEIIANFQNFSNF
QEQFTNTAKTLFGSGYVWLSRNPREQTLIIHTTANQDSPISDKLRPILVIDIWEHAYYLK
HQNKRPDHIQDWWALVDWGQVKALSDWWAAYDAGHDEL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcggttcagcaagtgttctgcaccattattttcgtggtgacgatcctgagtaatgcg
tctgctcaagactccatgccttctccaaggagacagccgaagtggtgtcccgtggaggtt
caggaggtaaaaccgtacagagtgcggtcaggttcccggacagagtgtcgcagggcctgc
acgtggaacaggttctgctgcgagttcaacatcatccctgtctataccactgcatatcgc
caggtgtcgcgacaggagtggaaatgctgtgacgacacagtgccctgcccagataaaacc
gtgtcagtggacacaccgtacaaggggatccagctcttcgcggacgagtacccagtgcca
ccgctgccgtacgagtacgatgcgttagagccgtatattgacgagaggactgcgcgagtc
caccacctcggtcaccacgcgggctacaccaagaagatgaacgctgctctgaaggcgtgg
agagacgaggtgggaccaggggtgggtctccagtccaactccatcctccatatcctggag
aacctgaaccaggtcccagacaagcacagaactgccatcaggaacaatgggggaggtttt
gtgaaccatgccatctactgggcgaccatgtccccccggagagagggtgagccccccaga
cttcctgaagccaccctggccaccgagatcatcgctaacttccagaacttcagcaacttc
caggaacagttcacaaatactgccaagactctgtttggttcaggttatgtgtggctgtcg
cgcaatcccagagagcagaccctaatcatccacacaacggccaatcaggactctcccatc
agcgacaaactccgcccgatcctggtgattgacatctgggagcacgcctactacctaaag
caccagaacaaacgtccggaccacatccaggactggtgggcactggtggactggggacag
gtcaaggcgctctctgattggtgggcagcatatgatgctggtcatgatgagctgtga

DBGET integrated database retrieval system