KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_277744Help
Entry
BRAFLDRAFT_277744 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 361 aa AA seqDB search
MIWCLLLLALAARGDAWLFSCSASDFQCSNGNCIPGSWECDGEADCSDGSDEASCSGGGT
CQQGVHFFCANGLYCIDSNWVCDGDNDCGDMSDEQNCGGGSTGTTGTTAPITSFTGDCGQ
PAISPQNVRVVGGVQAVQGSWPWQASLKLYGGHVCGGQIIAPNWIVTAAHCVDGQSNPSQ
WRVSLGSHRRTSTDSTQQDFSVTRIIMHESYDSNRINNDVALMKLSGNAQFNNYVSPICL
PTQDVAAGTNCVTTGWGDTGSGASTYLMQATVPIMEWNKCNSAQYMNGAITDKMICAGYD
QGGKDACQGDSGGPLVCNYSGKWTLDGIVSWGYGCAQAYKPGIYTRVTQFVSWINNKMAS
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatttggtgccttcttcttcttgctctggctgcccgcggagacgcgtggctgttcagc
tgcagcgcctcagacttccagtgcagcaacgggaactgcatccccggcagctgggagtgc
gacggcgaggccgactgctcagacggctcggacgaggcgagctgcagcggcggcggaacc
tgccagcagggcgtgcatttcttctgcgctaacgggctgtactgcatcgactccaactgg
gtctgcgatggggacaacgactgcggagacatgtctgacgaacagaactgcggaggtggc
agcaccggcaccaccggcaccaccgcgcccatcacttccttcaccggcgactgcggccag
cccgccatctccccgcagaacgtgcgcgtggtaggcggtgtgcaggccgtgcagggctcc
tggccgtggcaggccagcctcaagctgtacggcggccacgtgtgcggcgggcagatcatc
gctcccaactggattgtcaccgctgctcactgcgtggacggacagagcaaccccagccag
tggcgcgtgtccctgggctcccaccgccgtacctccactgactccacccagcaggacttc
agcgtcaccaggatcatcatgcacgagagctacgactccaacaggattaacaacgacgtt
gccctgatgaagctgagcggaaacgcgcagttcaacaactacgtcagcccgatctgcctg
ccgacccaggacgtggccgccggaaccaactgcgtcaccactggatggggcgacactggc
tccggtgcgtccacctacctgatgcaagccactgtgcccatcatggagtggaacaagtgt
aacagcgcccagtacatgaacggcgccatcaccgacaagatgatctgtgccgggtacgac
cagggaggcaaggacgcctgccagggtgactccggcggccccctggtctgtaactacagc
ggaaagtggaccctggacggcatcgtgtcctgggggtacggctgtgcgcaggcgtacaag
cccggcatctacacccgcgtcacccagttcgtcagctggatcaacaacaagatggcgtcc
aactag

DBGET integrated database retrieval system