KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_97108Help
Entry
BRAFLDRAFT_97108  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     BRAFLDRAFT_97108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 739 aa AA seqDB search
MGKCVSKNREEKDLQPVNVEPVANARTARSVGNAPGPRRLTLLAENLDQCLQVSDVYFRL
SYNRRAHHTEEYESFQLIVRRGQPFQLSLAFDKPYTEENSQVTLEFHTGDSPKISDGTLA
RVPVDSPLGGTSWGAKVTDKGLKTIDLLVQAPPNAIVGKYSIVVETILDGHKYRTERDPY
SHIYILFNPWCKDDSVYLNDEEELQEYIMNESGIIYVGNKRQVMERPWNYGQFEMPVLDA
SLELLDKAKFPPRARWDPIRLVRVVSKMVNSQDEDGVLVGNWSGEYEDGIRPSAWNGSVE
ILQQYHVRKEPVCYGQCWVFAGVTTSVLRSLGIPSRSVTNFASAHDTDGNLVVDIHYDEE
FTPIDYLNTDSTWNFHVWNEAWMTRPDLPAGYGGWQAFDATPQETSEGHYKCGPASVHAI
KNGHVYYGYDAKFIFAEVNADSISWVCPEDGPMYQVWQQEKGIGVKISTKAVGKDEREDI
TDHYKYSEGTEEERLAVEKAVSHGSRPHTYGERPEKADVEFSINAPKEVIVGHDFTASVT
LRNHSNQERSVSMFLTAHTMYYTGVPVTQFHKEKFVVTLQPNGQMTLHAQIEPAQYMSYL
VDQGAIKLNLLGRVKENKCTFAGQTDFRFSVPKLNIHIPARERPDFPVGEEFVVELSFKN
PLSVKLTNTEFHVEGPGIQKPKLISYRDVRPLEAARTLVTMKPVRPGNRKIIANFQSKQL
HDVQGHLEIQVTEDDVIDE
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggggaagtgtgtatccaagaacagggaagagaaggacctacagccggtaaatgtcgag
cccgtggcgaacgcaagaaccgcgcgatctgtcggcaacgctcctgggccgcggaggctc
acgcttctggcagagaacctcgaccagtgccttcaggtgtctgacgtgtatttccggctg
tcctacaaccggcgcgctcaccacacggaggagtacgagagcttccagctgatcgtcagg
cgcggacagcccttccaactcagcctcgccttcgacaaaccctacacggaggaaaactca
caagtcacgctcgagtttcacacaggcgactccccgaagatcagtgacggcacgttggcc
cgggtcccggtggacagtcctctgggcggcacgtcatggggggcaaaggtcacggacaag
ggtctgaagaccatcgacctgttagtccaggcgccgcccaacgctatcgtcgggaagtac
agcatagttgtagagacgatattggacggacacaagtaccggacagagagggacccgtac
tcacacatctacatactcttcaacccatggtgtaaagacgattctgtgtacctgaatgac
gaagaagagctgcaggaatacatcatgaacgaatccggcatcatttacgtcggtaacaag
aggcaagtcatggagaggccctggaactacggacagttcgagatgcctgttctggacgcc
tcgcttgagctgctggacaaagccaagtttccaccaagggcgcgctgggacccgataagg
ctcgtcagagtcgtctccaaaatggtgaacagtcaggacgaggacggggtgctggtaggg
aactggtcgggggagtatgaggacggcatccgcccgagcgcctggaacggcagcgtggag
atcctgcagcagtaccacgtcaggaaagaacccgtctgttacgggcagtgctgggtgttc
gcaggcgtcaccacttcagttctccgcagcctgggcatcccgtcccgcagcgtgaccaac
ttcgcctcggcgcacgacacggacgggaacctggtggtcgacatccactacgacgaggag
ttcacacccatcgactacctcaacacggactcaacatggaatttccacgtgtggaacgag
gcgtggatgacccggccggacctgccggctgggtatggcggctggcaggcgttcgacgcc
acaccgcaggagacaagcgagggacattacaagtgtggcccggcgtctgtccatgccatt
aagaacggccatgtttactatggttacgacgccaagttcatcttcgcagaggtcaacgcc
gacagcatctcatgggtgtgtcctgaggacgggcccatgtaccaggtgtggcagcaggaa
aagggtataggcgtaaaaatcagcaccaaggcagtaggaaaggacgagagagaagacatc
acagaccactacaagtattccgagggtacggaagaagagcgacttgctgttgaaaaggcg
gtaagccacggcagcagaccgcacacgtacggcgagagaccggagaaagcagacgtcgag
ttttccattaatgctccaaaagaggtcatcgtaggacacgacttcacggccagcgtgacg
ctgcgtaaccatagcaaccaagagaggagcgtcagcatgttcctgacggcacataccatg
tactacacgggggtgccggtcacacagtttcataaggagaagtttgtggtgacgctacag
ccaaatggacaaatgacgttacacgcacagattgagcccgcccagtacatgtcgtatctg
gtagaccagggtgccatcaaactcaacctgttggggcgagtcaaagagaacaagtgcacg
tttgccgggcagacagacttccgcttcagcgtgcccaagctcaacattcacatcccagca
agagagagacctgacttccccgtcggagaagagtttgtggtcgagttgtctttcaagaac
cctctatcggtcaaacttacaaatacagagttccacgtcgagggacccggaatccagaaa
ccgaagctcatttcatacagagatgtccgtcccctggaagctgccaggacgttagtgacc
atgaaaccagtccggccgggcaacaggaagatcatcgctaacttccagtccaaacaactc
cacgatgtacagggacatttggaaatacaggtcacagaggacgacgttatagacgaatga

DBGET integrated database retrieval system