KEGG   Bacteroides fragilis YCH46: BF2578Help
Entry
BF2578            CDS       T00202                                 

Definition
(RefSeq) putative phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BF2578
Enzymes [BR:bfr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BF2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2962566..2963873)
Genome map
AA seq 435 aa AA seqDB search
MIDRKKVYVGMSADIIHPGHLNIIHEAQKLGYVTVGVLTDAAISSYKRLPYLNYEQRSLI
VKNLKGVEEVIPQSTLDYVPNLELLRPDFVVHGDDWKEGVQKETRQRVIDTISKWGGKVI
DVPYTKGISSTQLNSKLKEIGTTPEIRLKRLRRLIEAKSIVRICESHSGLTGLIIENTSV
EVNGIRREFDGMWSSSLTDSTSKGKPDIEAVDLTTRLHDLNDALECTTKPIIFDGDTGGK
IEHFVFTVRTLERLGISAVIIEDKIGLKKNSLFGTDAIQTQDTIDGFCNKIRAGKRAQIT
DDFMIIARIESFIAGKGQEDAMERALAYIEAGADGIMIHSKDKSGEDIRLFCKALRLANQ
SVPIVVVPTTYNHVTEEELSLWGANIVIYANHMLRSAYPAMLNTAKSILSHGRSYEANEL
CMPVKEILELIPGTK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatagataggaaaaaggtatatgttggtatgagtgcagatatcattcatccaggacat
ttaaatattattcatgaggctcagaaattaggatatgtgactgttggggtcttaacagat
gcagctatttctagttataagcggcttccttatttgaattatgaacagcgttcgttaatc
gtgaaaaatttgaaaggtgtggaggaggttatcccccaatccactcttgattatgtacca
aatttagagttgttaaggcctgatttcgttgttcatggtgatgactggaaagaaggagta
cagaaagaaactcggcagagagttattgatacgatctctaaatggggtggaaaagttatt
gatgttccttatacaaaaggtatctcttccacccaacttaactctaaattgaaagaaata
gggacgactccagaaattcgcttaaaaagactgaggcgtttaatagaagcaaaatcgatt
gttcgtatctgtgaatcacatagtggccttacgggattgattatagaaaatacttcggtt
gaagtaaatggaataaggcgcgagtttgatggcatgtggtccagtagtttgacagattcc
acatctaaaggtaagccggacattgaagctgttgatttaacgactcgacttcatgatttg
aatgatgcgttagagtgtacaacgaagcccataatttttgatggtgatacaggaggtaaa
atagaacattttgtttttacggttcgtacattggaacgtttgggtatttctgctgtaatt
attgaggataagattggattaaaaaagaattccctttttggaacggatgcgatacaaact
caagatacgattgatggcttttgtaataaaatacgtgcaggtaagcgtgcacaaattact
gatgatttcatgattattgctcggatagaaagttttatagcaggaaaaggacaagaagat
gcgatggaaagagctcttgcgtatattgaggctggtgctgatggtattatgattcatagt
aaggataaatcaggagaagatataaggcttttctgtaaggcacttcgtcttgctaatcaa
tccgttcctattgtagttgtacctacaacttataatcatgtgacagaagaagagttatct
ttatggggagctaatattgtaatctatgctaatcatatgcttcgaagtgcttatcccgct
atgctcaatactgcaaaatccattttatcacatgggcgttcttatgaggctaatgaattg
tgcatgcctgttaaagaaattttggaattaatacctggtaccaaataa

DBGET integrated database retrieval system