KEGG   Bacteroides fragilis YCH46: BF2578Help
Entry
BF2578            CDS       T00202                                 

Definition
(RefSeq) putative phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00440  Phosphonate and phosphinate metabolism
bfr01100  Metabolic pathways
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BF2578
Enzymes [BR:bfr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BF2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 3083683
NCBI-ProteinID: YP_099862
UniProt: Q64T51
LinkDB All DBs
Position
complement(2962566..2963873)
Genome map
AA seq 435 aa AA seqDB search
MIDRKKVYVGMSADIIHPGHLNIIHEAQKLGYVTVGVLTDAAISSYKRLPYLNYEQRSLI
VKNLKGVEEVIPQSTLDYVPNLELLRPDFVVHGDDWKEGVQKETRQRVIDTISKWGGKVI
DVPYTKGISSTQLNSKLKEIGTTPEIRLKRLRRLIEAKSIVRICESHSGLTGLIIENTSV
EVNGIRREFDGMWSSSLTDSTSKGKPDIEAVDLTTRLHDLNDALECTTKPIIFDGDTGGK
IEHFVFTVRTLERLGISAVIIEDKIGLKKNSLFGTDAIQTQDTIDGFCNKIRAGKRAQIT
DDFMIIARIESFIAGKGQEDAMERALAYIEAGADGIMIHSKDKSGEDIRLFCKALRLANQ
SVPIVVVPTTYNHVTEEELSLWGANIVIYANHMLRSAYPAMLNTAKSILSHGRSYEANEL
CMPVKEILELIPGTK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatagataggaaaaaggtatatgttggtatgagtgcagatatcattcatccaggacat
ttaaatattattcatgaggctcagaaattaggatatgtgactgttggggtcttaacagat
gcagctatttctagttataagcggcttccttatttgaattatgaacagcgttcgttaatc
gtgaaaaatttgaaaggtgtggaggaggttatcccccaatccactcttgattatgtacca
aatttagagttgttaaggcctgatttcgttgttcatggtgatgactggaaagaaggagta
cagaaagaaactcggcagagagttattgatacgatctctaaatggggtggaaaagttatt
gatgttccttatacaaaaggtatctcttccacccaacttaactctaaattgaaagaaata
gggacgactccagaaattcgcttaaaaagactgaggcgtttaatagaagcaaaatcgatt
gttcgtatctgtgaatcacatagtggccttacgggattgattatagaaaatacttcggtt
gaagtaaatggaataaggcgcgagtttgatggcatgtggtccagtagtttgacagattcc
acatctaaaggtaagccggacattgaagctgttgatttaacgactcgacttcatgatttg
aatgatgcgttagagtgtacaacgaagcccataatttttgatggtgatacaggaggtaaa
atagaacattttgtttttacggttcgtacattggaacgtttgggtatttctgctgtaatt
attgaggataagattggattaaaaaagaattccctttttggaacggatgcgatacaaact
caagatacgattgatggcttttgtaataaaatacgtgcaggtaagcgtgcacaaattact
gatgatttcatgattattgctcggatagaaagttttatagcaggaaaaggacaagaagat
gcgatggaaagagctcttgcgtatattgaggctggtgctgatggtattatgattcatagt
aaggataaatcaggagaagatataaggcttttctgtaaggcacttcgtcttgctaatcaa
tccgttcctattgtagttgtacctacaacttataatcatgtgacagaagaagagttatct
ttatggggagctaatattgtaatctatgctaatcatatgcttcgaagtgcttatcccgct
atgctcaatactgcaaaatccattttatcacatgggcgttcttatgaggctaatgaattg
tgcatgcctgttaaagaaattttggaattaatacctggtaccaaataa

DBGET integrated database retrieval system