KEGG   Bacteroides fragilis YCH46: BF3209Help
Entry
BF3209            CDS       T00202                                 

Definition
(RefSeq) alpha-amylase precursor
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF3209
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BF3209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3636718..3638163
Genome map
AA seq 481 aa AA seqDB search
MENGVMMQYFEWNLPNDGNLWKQLKEDASHLHEIGVTAVWIPPAYKADEQQDEGYATYDL
YDLGEFDQKGTVRTKYGTKEELKEMIDELHKNHISVYLDVVLNHKAGGDFTEKFIVVEVD
PNDRTQALGKPFEIQGWTGYSFHGRKDKCSDFKWHWYHFSGTGFDDAKKRSGIFQIQGEG
KAWSEGVDNENGNYDFLLCNDIDLDHPEVVTELNRWGKWVSKELNLDGMRLDAIKHMKDK
FIAQFLDAVRSERGDKFYAVGEYWNGDLNTLDAYIKSVGHKVNLFDVPLHYNLFQASQEG
KNYDLQNILKNTLVEHHCDLAVTFVDNHDSQSGSSLESQIEDWFKPLAYGLILLIKDGYP
CLFYGDYYGVKGENSPHTQIINILLDARRKYAYGDQIEYFDHPSAIGFIRTGDEEHVGSG
LVFLMSNDEAGSKKMDLGEEHKGEIWHEITGNIQQEITLDEKGSGEFSVNTRNIAVWIKK
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtgtaatgatgcagtattttgaatggaatctgccaaatgacggaaattta
tggaaacaattaaaagaagatgcgtcacatttacatgagattggtgtgacagcagtatgg
attccccccgcttacaaagccgacgaacaacaagacgaaggttatgcaacctacgatttg
tatgatctcggcgagttcgatcaaaaaggaaccgtaagaacgaaatatggtacgaaagaa
gaactgaaagaaatgatcgatgaattacataaaaatcatatttccgtttatctggatgta
gtactgaatcataaggcaggaggtgatttcactgaaaagttcatagttgtagaagtcgat
cccaatgatagaacccaagcattaggaaaaccgttcgaaatacagggctggaccggatac
agcttccatggacgtaaggataaatgttcagacttcaaatggcattggtatcatttttca
ggaaccggttttgacgatgccaaaaagcggagtggcatcttccagatacagggtgaaggc
aaagcgtggagcgaaggggttgacaatgaaaatggcaactacgatttcttattatgcaat
gatatagacctggatcatcctgaagtagtcaccgaattgaatcgttggggaaaatgggtt
tccaaagagctgaacctcgacggaatgcgtctggatgccatcaaacacatgaaagacaag
ttcattgcacaattcctggatgcggtaagaagcgaaagaggagacaaattctacgctgtt
ggcgaatattggaatggtgatttgaacacactcgatgcatacataaaatccgtgggtcac
aaagtcaacctatttgatgttccattacattataatttattccaagcatcacaagaaggc
aagaattatgatctgcagaatatcctaaaaaacacattagtcgagcaccactgtgatctg
gcagtcacttttgtcgacaatcacgattcgcaatcgggcagttccttggaatcacaaata
gaagactggttcaaaccattggcctatggtctgatattattaataaaagacggttatcct
tgtttgttctacggagattattatggtgtcaaaggagaaaactcacctcatacccaaatc
attaatattcttctggatgccagaagaaaatatgcttatggcgatcagattgagtatttc
gatcatccttccgccattggctttattcgtacgggagatgaagaacatgtcggttccggt
ttagtctttttaatgtctaatgatgaagccggcagtaaaaagatggatttgggcgaagaa
cataaaggtgaaatatggcatgaaataaccggaaatattcagcaagaaatcacattagac
gaaaaaggaagtggagaattttctgttaatacccgtaatattgctgtttggataaaaaag
aattaa

DBGET integrated database retrieval system