KEGG   Bacteroides fragilis NCTC9343: BF9343_1814Help
Entry
BF9343_1814       CDS       T00239                                 

Gene name
aepX
Definition
(GenBank) putative LPS biosynthesis related phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BF9343_1814 (aepX)
Enzymes [BR:bfs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BF9343_1814 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
UniProt: 
LinkDB All DBs
Position
2214607..2215908
Genome map
AA seq 433 aa AA seqDB search
MNKKIYVGMTADIMHPGLIHIIHEATKYGDVIVGLLTDKAIAEHKRLPYLTYDQRKEVVE
NIKGVCEVVPQEDWSYVPNLEKLKPDYIIHGDDWKTGPLREVREQVFEVMNAQGGKVIEI
PYTRGINSSSLDKDIKAIGTTPDVRLKSLRRLIQAKPVVRILEAHDGLCGLIIENLEVQK
GDKREVFDGMWSSSLTDSTSKGKPDIEAVDLTTRLQDLNNILECTTKPIIFDGDTGGKIE
HFVFTVRTLERHGISAVIIEDKVGLKKNSLFGTDAIQTQDSIEGFCDKIRAGKNAQVTGD
FMIIARIESLIAGKPMSDALERAYAYVQAGADGIMIHSKDKSGEDIREFCRTFRKEYAHV
PIVVVPTTYDHVHESELHEWGANVVIYANHLLRAAYPAMMNVARTILENERAEEVRPLCM
PIKEILELIPGTK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaaatctatgtcggtatgaccgcggatatcatgcatccggggctgatccat
attattcatgaagctactaaatacggtgatgtcatcgtcggtctgctgacggacaaggcc
atcgccgaacacaaacgcctcccttaccttacctatgatcagcgtaaggaggttgttgag
aatatcaagggggtttgcgaggttgttccccaggaggattggagctatgttccgaatctg
gaaaaactcaagcctgactatatcatccacggtgacgactggaaaacgggtccgttgcgc
gaggtgcgcgaacaggtttttgaggtgatgaacgcccaggggggcaaggtaatcgagatc
ccttatacccggggcatcaactcctcctcgctcgacaaggatatcaaggcgatcgggact
acccctgacgtacgtcttaagtccctccgccgcctgatccaggccaagcctgtggtccgt
atcctggaggctcacgacggtctttgcggtctgattattgagaatcttgaagtccagaag
ggtgataagcgcgaggtctttgacggcatgtggtccagcagcctgaccgactccacgagt
aagggtaaaccggatattgaagcggtcgaccttaccacccgtttacaggacctgaacaat
atccttgaatgtaccaccaagcctattatttttgatggagacacgggtggcaagatcgaa
cactttgtctttactgtgcgcactctggaacgtcacggcatttctgcggtaatcattgaa
gataaagtcggtctgaagaagaattccctttttggtactgacgctatccagactcaggat
agtatcgagggtttctgcgataagatcagagcagggaagaatgcccaggtcaccggtgac
tttatgatcattgcgcgtatcgaaagccttattgccggcaaacccatgagtgacgccctc
gaacgtgcttatgcctatgtacaggcgggtgcggacggcatcatgatccacagcaaggat
aagtcgggtgaggatatccgtgagttctgccggactttccgcaaagaatacgcccatgtt
cccattgtcgttgttccgacgacttatgaccatgtgcacgaatccgaacttcacgaatgg
ggtgccaacgtagtcatttacgccaaccaccttctccgtgccgcttacccggccatgatg
aacgtggccaggaccatccttgaaaacgagcgcgccgaggaggtccgtccgctttgtatg
cctatcaaggaaattctggaattgattccgggcactaaataa

DBGET integrated database retrieval system