KEGG   Botrytis cinerea: BC1G_01910Help
Entry
BC1G_01910        CDS       T01072                                 

Definition
(RefSeq) manganese superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bfu  Botrytis cinerea
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    BC1G_01910
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BC1G_01910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 230 aa AA seqDB search
MSTTLLRTSTAARAALRASSSKRAASMASTSFIRGKATLPDLPYDYGALEPSISGKIMEL
HHKNHHQTYVNSFNAASEQVEAATSKGDIAAAIALQPLINFHGGGHVNHSLFWENLAPSK
NGGGGEPTGALKTAIETSYKDFSTFKTKFNAALAGIQGSGWAWLVKDNETGQVQIRTYAN
QDPVVGKYTPLLGVDAWEHAYYLQYQNRKAEYFGAIWDVINWKTVESRLK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccacactgcttcgcacatctaccgcagctcgtgctgctcttagagccagctct
tctaaacgagctgcctcaatggcaagcaccagtttcatccgtggaaaggctactcttcca
gatctcccatatgattacggtgcgctcgaaccctcgatctccggtaagatcatggagctt
catcacaagaaccatcaccaaacctacgttaacagctttaacgctgcgagcgagcaagtc
gaggccgctacatccaagggagacattgctgctgccattgcattgcaacccctcatcaac
ttccacggaggcggacatgtgaaccatagcttgttctgggagaatttggcaccaagtaag
aatggtggtggtggagaacccacaggtgctttgaagactgccatcgagaccagctacaaa
gatttctcaaccttcaagacaaaattcaacgcggctttggcaggtatccaaggaagtgga
tgggcgtggttggtcaaggacaacgagactggtcaagtccaaattagaacatatgcaaac
caggatccagtcgtaggcaagtacactccattgttgggtgttgatgcttgggagcatgcg
tactatcttcaataccaaaacagaaaggctgagtattttggtgctatctgggatgtaatt
aactggaagactgtggagagcagattgaagtga

DBGET integrated database retrieval system