KEGG   Botrytis cinerea: BC1G_11987Help
Entry
BC1G_11987        CDS       T01072                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
bfu  Botrytis cinerea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1G_11987
Enzymes [BR:bfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     BC1G_11987
Glycosyltransferases [BR:bfu01003]
 Polysaccharide
  Storage polysaccharide
   BC1G_11987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 714 aa AA seqDB search
MSGKTNRDVKNHFLFEIATEVANRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNRQSAAV
EVEALTPTNPHLAATIEAMEERGIQMVYGRWLIEGAPRVLLIDTKSAYRFLDEWKADLWN
TAGIPSPPGDDETNEAVVFGYLVAWFLGEFVAHEKEKAVIAHFHEWLSGVALPLCKKRRI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAATHSCDVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQAKEKIHDFVRGHFYGHN
DFDPENTLYFFTAGRYEYRNKGVDMFIESLARLNHRLKSAGSKMTVVAFIIMPAQTQSLT
VEALKGQAVIKSLRDTVDVIERGVGKRIFERALKWHEGEVMPDEKDLITSQDRILLRRRL
FAMKRHGLPPIVTHNMANDSEDPILNQIRRVQLFNHPSDRVKVVFHPEFLNSANPVLPMD
YDEFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSTDYGIYI
VDRRMKGVDDSVNQLTSYMFDFAGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQLA
LRRAYPASFDGEEEDDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREGLSTE
DYVSWKLPEEEDPDEYPFPLTLRTKKPNGSQSPYGYGGAQSPSEYAITNGNGMK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaaaacaaaccgtgatgtcaaaaaccactttctctttgagatagccaccgaa
gttgcgaatcgagttggtggtatctattccgtcatcaaatcaaaagcaccagtcaccaca
gcagaatatggagaccgatacactcttattggccctctcaacaggcagtcggccgcagtg
gaagtcgaggcattaaccccaacgaacccccaccttgcagcaacgatagaagctatggaa
gaaagaggaattcaaatggtatatggccgctggttgattgagggtgcccccagagttctc
ttgatcgacaccaagagtgcctacagatttttggatgagtggaaggccgatctgtggaat
actgctggaattccatctccgcctggtgatgacgaaaccaacgaagcagttgtcttcggt
tacttggttgcgtggttcttgggagagttcgtcgcacatgaaaaagaaaaggccgtcatt
gcacatttccacgagtggctctccggtgtcgcacttcctctatgcaaaaagcgccgtatc
gatgttactacaattttcaccacccacgcaactctccttggaagatatctctgtgcagga
tctgtggacttttacaacaacttgcagtggtttgacgtggatgccgaggcaggaaaacgt
ggtatctatcacagatactgcatagaacgtgcggcgacgcattcttgtgatgtctttacc
actgtttcacatatcaccgcatatgagtctgagcatctcttgaagagaaagccagatggt
gttcttcccaacggtctcaatgtcaccaaattctctgccatgcacgagtttcaaaacttg
catcaacaagccaaggagaagattcacgactttgttagaggtcatttctatggacacaac
gattttgatcctgaaaacacactttacttcttcacagcaggacgttatgagtacagaaat
aagggtgttgacatgttcatagagtcattggctcgtttgaatcaccgcctgaagtccgct
ggatcaaagatgacggtggtcgcattcatcatcatgccagcacaaacccaatcattaact
gtcgaagctctcaagggacaagccgtcattaaatcattacgtgacacagttgatgttatt
gagcgcggtgtcggaaagagaatctttgagcgtgcccttaagtggcatgagggtgaagtg
atgcctgatgaaaaggacttgatcaccagtcaagatcgcatccttctccgcagacgtctg
tttgccatgaagagacatggacttccaccgatcgtcactcataacatggcaaatgattct
gaagacccaattttgaaccaaatccgcagagttcaactgttcaaccatccttcggaccgt
gtcaaggtcgttttccatcccgagttcttgaactctgccaacccagtcctaccaatggac
tacgatgagttcgtcagaggtacccatttaggtgtcttctcatcctattatgagccatgg
ggttacacaccagcagagtgtacagtcatgggtgtgccaagtatcacaaccaacttgtca
ggtttcggttgttacatggaggagttgattgaaaactcaacagattacggtatttacatt
gtcgaccgtagaatgaagggtgtcgatgactcggtgaaccagcttaccagttacatgttt
gatttcgctggtaagagcagacgccagcgtatcaaccagagaaatcgtaccgagcgatta
agcgatcttctcgactggaagcgcatgggaatggaatacgtcaaggcaagacaattggca
ttaagaagagcataccctgcatcattcgacggcgaagaagaggatgacttcattcctggt
gtggaacaaaagatttcacgcccattctcggtacccggatccccaagagatagaaccggt
atgatgacacctggtgattttgccagtctgcaagaaggacgtgaaggcttgagcacagaa
gattatgtttcctggaagcttcctgaagaggaagacccagatgagtacccattcccactc
accctccgaacgaagaaaccaaacggatctcagagcccatatggatatggcggtgcacaa
agcccatcggagtatgccataactaatgggaacgggatgaagtga

DBGET integrated database retrieval system