KEGG   Botrytis cinerea: BC1G_14780Help
Entry
BC1G_14780        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
Organism
bfu  Botrytis cinerea
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 1233 aa AA seqDB search
MEGVNAGNGADEKNFVKGKNKLGSKYRNYFTGKFQGKSKKGEKLDQKDPRKENTRSNSEP
TPRLVPILKSTPGSTSEPTSVPTPQSQLQSQSHSQPKSQPRTITTVTIMPPKSSPTQPRW
ISDISKTTPTIVSDIESATHSVHSIFHDLKTITPEDANTLLQLFSSQIKGVQNDNTLLLE
KTVKLLASQPEDSQIGKSLTASFVNTLWDALPHPPVRSLDKKFMYRDADGGNNNILMPDL
GRAGTAYAKSVKPERMRKKNLPDPGELFDGLMRRGGLDGEEDFKGSQTGISSQLFYLATI
IIHDLFLTDHEDMTKSKTSSYLDLAPLYGCNQEEQNAVRTFEDGKLKPDCFSSKRILGFP
PGVGVFLIMFNRFHNHVVGMLAQINDNGRFTKPKAEAAKSAFDKYDNDLFQTGRLITCGL
YVNIVLKDYVRTILNLNRTTSKWDLDPRVSETKTLLNKPAAEGVGNQVTAEFNLIYRWHS
AISQRDEKWTNAEYARLFPNKNPTDVTLPELLRGLHSMEADLPVDPSQRSFADLNRLSNG
SYDDESLVSIFESSVEDLSGAFGATNVPPIMRSIEILSILQSRSWNMCTLNEFRSFVGLS
RHTSFADINPDPVIAKRLKEFYGSPDDVEFYPGVVVEKIKPPVVPGSGLCTGYSISYSIL
SDAVGLVRGDRFYTTDYTPESLTNWGYNEVQFDTDIDDGAVLYKLVLRAFPNHFQGNSIY
AHFPFVTPEANLKIQKDLGRENLYSWDKPKKKADTPTVESWEECKKILNDKANWKVTWGP
PIAVLTSQSPSDSKTTGPPKIPPFCLAGDESINTTSRSLIISSFHDLPTGHGNKNDKEHP
DWQSAVAQFYTVNTADLFDKHKVLIPTVNAYSNANGNGSTTKNGAAAPKKTYRVDVVADI
CNRVFTRFAAGVFDFPLKLGMGNTVDVNVTTDIEDGFTEEELYTALSTGFICIFNNFDVT
KSFVVNQEARAVAKKLGDILMENTKGGGIGDVVEGLKDRLHSIVHDDETERQTEEKVLKE
KERLALKGLPTSAAMTANQSQLLSQVLGYYLSDAGSSHLPQLYTIAHETTKESDDLLLHY
FLEAARLRGTVALFRLYSPSQSTSQATTTTNPAPGTVVLLNLPLAHQDPTAFPNPETVVL
DRSLDSYLMFGHGPHECLGRDIALAGMVRVFRLIVGLKNLRLDAGSSGYSRKSVAGEAKG
MKTVETEYGIAYLDDELSTLGPFPKGLRICWDE
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgtcaacgcggggaatggagcggacgagaaaaattttgtgaaggggaagaac
aagttgggttcaaaatacagaaattattttacagggaaatttcaagggaaatctaagaaa
ggtgagaagttggatcagaaagatccacgaaaagaaaatactcgatcgaattcagaaccg
acaccgagactagtaccaatattgaaatcgacgcctggctcaacgtcagaaccaacatca
gtaccaacacctcaatcacagcttcaatcacagtcacattctcaaccaaaatctcaacca
agaaccataaccacagtcacaatcatgcctcctaaatcatctccaacccaaccacgttgg
atctccgatatttccaaaacaacaccgacgatagtctccgatatcgaatccgcaactcat
agtgtccattccatctttcatgacctcaaaaccatcaccccagaagatgcaaacacactt
ctccaactcttttcctctcagatcaagggtgtccaaaatgacaacacgctccttcttgag
aagacggtgaaactcctggcgtctcaaccggaagactcacagattggaaaaagtctaaca
gcaagttttgttaatacgctatgggatgccttgccgcacccacctgtgaggagtttagat
aagaagtttatgtatagagatgcggatggaggaaataacaacattctgatgccggattta
ggaagagcggggacagcatatgcaaagagtgttaaacctgagagaatgagaaagaagaac
ctgccggatcccggggagcttttcgatggcttgatgaggaggggcggattggatggagaa
gaggacttcaagggaagccagactgggatcagtagtcagctgttctatctggctacgatt
attatccatgatcttttccttacggatcatgaagatatgacgaaatcgaagactagtagt
tacttggatctcgcacctctctacggctgtaatcaagaagagcaaaatgcggtccgaaca
ttcgaggatggtaaactcaaaccagattgtttttcttcgaagagaatcttaggatttccc
cccggtgtgggagtcttcttgatcatgttcaaccgatttcacaatcatgtggttggaatg
cttgctcaaatcaacgataatggccgtttcacaaaacccaaagcagaggcggcaaaatct
gcattcgataaatacgacaacgacctctttcaaacaggtagactcattacttgtggctta
tatgtcaatatcgttttgaaagactatgttcgtacgattttgaatctcaatcgtacaact
tcaaaatgggatttggatccaagagtctctgagactaagaccctcttgaacaagcctgct
gcggagggtgtaggaaatcaagtcactgctgagtttaatttgatctaccgctggcactcg
gctatctcccaaagagatgagaaatggaccaacgcagaatacgctagactatttcctaat
aagaacccgactgatgtcacgcttcccgaacttctcaggggcctccactcaatggaagca
gaccttcctgtcgatccatctcaacgctctttcgcagatctcaatcgtttgtctaatggg
tcatacgatgatgaatcgctcgtatcaattttcgaatcctcagtagaagatctctctggt
gcctttggggccacaaacgtcccacctatcatgcgctctatcgaaatcctctctattctc
caaagtcgctcttggaatatgtgcacccttaatgaattccgttcattcgtcggattatca
cgtcatacatcgtttgcggatataaatcccgaccctgttattgcgaaacgactcaaagaa
ttctatgggagtcctgacgatgtggaattttatccgggagttgtggttgaaaaaattaaa
ccaccggtggtaccaggtagtggtttatgcactggatatagtatcagttatagtattttg
agtgatgcagtagggctggttaggggagatagattttatactacagattacacgccggag
agtcttactaattggggatacaatgaagtacaattcgacacagacatcgacgatggtgct
gtactttacaaattagtccttcgagctttcccaaaccacttccaggggaactctatatat
gcacatttcccattcgttacacctgaggctaatcttaaaatccaaaaggatttggggaga
gaaaatttgtatagctgggataaacctaagaagaaggcagatacgccaacagtggagagt
tgggaagagtgcaagaaaatcttgaatgataaggctaattggaaggtaacatggggtcca
ccaattgccgtcctaacttcacaatcgccctccgactcaaagactacagggccgccaaaa
atacctccgttctgtctcgcaggagatgaatccataaatacaacctcgcgctctcttata
atatcatctttccacgatcttccaaccggtcacggtaataagaatgataaagaacatcct
gattggcaatctgcagttgcgcaattctacacagttaacacggccgatttatttgataaa
cataaagttctcattccaactgttaatgcgtacagcaatgctaatggcaacggaagtaca
acaaaaaatggagctgcagcacccaaaaagacgtatagagtggacgtcgtagctgacata
tgcaatcgtgtcttcactcgtttcgcagccggcgtgtttgatttccccctgaaactcgga
atgggcaatactgtcgacgtcaacgtaactacggatattgaagacgggtttaccgaagag
gaactgtacacggcgctttccactggtttcatatgtatttttaacaattttgatgttaca
aaatcttttgtggtgaatcaggaagcaagagctgtggctaagaagttaggtgatattttg
atggagaatacgaaaggaggcgggattggagatgtggtggaggggctgaaagatagactg
cacagtatagttcatgatgacgagacggagagacagactgaggagaaagttctaaaggaa
aaggaaagattggcgctgaagggtcttcccacctcggcagctatgacggccaatcagtca
cagcttctctcccaagtcctgggctattacctcagtgatgccggatcatcacacctacca
cagctctacactattgcccatgaaactaccaaggagtctgatgatttactcttgcactac
ttcctcgaagcagcccgacttcgcggcaccgtcgcacttttccgtctctactcaccctcg
caatccacttctcaagccaccaccaccaccaaccccgccccaggaaccgtcgtactcctc
aaccttccccttgcccaccaagaccccaccgccttccccaatcccgaaaccgtggtcctc
gaccgaagtctcgactcttatctcatgttcgggcacggcccacacgaatgtctcggccgc
gatatcgctttagcggggatggtgcgcgtgtttagacttatcgtcgggctgaagaatttg
agactcgatgcggggtcgagtgggtatagtaggaagagcgtggcgggtgaggcgaaggga
atgaaaactgtggagacggaatatgggattgcgtatttggatgacgagttgtcgactttg
ggaccgtttccaaaggggttgaggatttgctgggatgagtag

DBGET integrated database retrieval system