KEGG   Brevibacterium flavum ZL-1: C628_08525Help
Entry
C628_08525        CDS       T04445                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bfv  Brevibacterium flavum ZL-1
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:bfv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    C628_08525
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    C628_08525
Enzymes [BR:bfv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     C628_08525
Bacterial toxins [BR:bfv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   C628_08525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1819460..1820491)
Genome map
AA seq 343 aa AA seqDB search
MLPIWMGLPFKKAGPLSRRKAVFSALGAAALIGAALPTIPTAQAQTPTGYGFDATASISE
EPEFSTQQLADGGTLGFDCYRIPSLGVAPNGNVLASWDGRPNNCSDAPQPNSIVGKVSTD
NGATWGEQHDISAGITAEPKTGYSDPSIVVDWERGDVFNFHVKSFDAGYFTSQPSTDPDD
RNVAHVAYAKSSDNGSTWVADSVITDQVVADDTWDSRFATSGNGIQLQYGAYKGRLVQPS
VTRMTNGRVAAVAMLSDDHCATWYPSAPWGNSMDENKIVELSDGTLMNNSRSSGADTYRK
VSYSTDGGVTWTELTLDTQLPDPRNNASLIRVFPTVPEGSAQA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaatctggatgggtcttccattcaagaaagcaggtcctttgtctcggcgtaaa
gcagtattctcagcgcttggtgcagccgcactcatcggcgcagcactacccaccatccca
acggcccaagctcaaacacccacgggctacggattcgatgcaacagcaagcatcagcgaa
gaaccagagttttcaacacaacaactcgctgacggcggaactctcggatttgattgctac
cgcatcccatcgcttggcgtcgcacccaacggcaacgtcctcgcatcgtgggatggtcgc
ccaaacaactgttcagatgctccacaacccaactccatcgtgggcaaggtatcgaccgac
aacggagcaacctggggcgaacagcacgacatttccgcaggtatcaccgccgaacccaaa
actggctattccgatcccagcatcgttgtggactgggagaggggcgatgtctttaacttc
cacgtgaagtcattcgatgcaggatacttcacctcccaaccaagcacggacccggatgat
cgcaacgttgcccatgttgcctacgccaaatcatcagataacggctcaacctgggttgca
gacagcgtcattactgatcaagtggttgctgatgacacctgggacagccgatttgccaca
tccggaaacggcatccaactgcaatacggcgcgtacaagggacgattggtccagccatcg
gtaactcgcatgaccaatggtcgagtcgcggcagttgccatgctgagtgatgatcactgc
gcaacgtggtaccccagtgctccttggggaaactccatggatgaaaacaaaatcgtggaa
ctcagcgatggaaccctgatgaacaacagtcgttcatcaggagccgatacttaccgcaag
gtgtcttattccaccgacggcggcgtcacttggaccgagctaactcttgatacccagctg
ccggatcctcgcaacaatgcttccctgattcgagtattcccgacagtacctgagggaagt
gcgcaggcatag

DBGET integrated database retrieval system