KEGG   Bacillus flexus: BC359_01860Help
Entry
BC359_01860       CDS       T04803                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bfx  Bacillus flexus
Pathway
bfx00240  Pyrimidine metabolism
bfx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BC359_01860
Enzymes [BR:bfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BC359_01860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 IMPDH
Motif
Other DBs
NCBI-ProteinID: AQX56375
UniProt: A0A1S6ZFK8
LinkDB All DBs
Position
366661..367272
Genome map
AA seq 203 aa AA seqDB search
MYVMKQSGWIEVICGSMFSGKSEELIRRVRRTQFAKQNVQVFKPAIDDRYSEEAVVSHNG
TSVIAHPISISTDILDIVSEATDVVAIDEIQFFDNQIVEVVQALADKGFRVIVAGLDQDF
RGEPFGHVPQLMAIAESVTKLQAVCASCGSPASRTQRLINGEPASYDDPIILVGASESYE
PRCRHCHVVKSSKAASNFQELTK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgtaatgaaacaaagcggttggattgaagtaatttgtggaagtatgttctcaggg
aaatcagaagaattaattcgtcgcgttcgtcgcacgcagtttgccaagcaaaatgtgcag
gtgtttaagccagcaatcgatgatcgatatagtgaagaagcggttgtatcacataatgga
acatcagttattgctcatcctatatctatttctactgacattttagatatagttagcgaa
gctacagatgtagtggcaatcgatgagattcaattctttgataatcaaattgttgaagtt
gtacaagctcttgcagataaagggtttcgtgtcattgtagcaggacttgatcaagatttt
cgtggtgagccttttggacatgtacctcagctgatggcaatagctgaatcggttacaaaa
ctgcaagctgtttgtgcatcatgtggatctccagcaagtcgtactcaacgtttaattaac
ggagagccagcttcttatgatgatcccattatactagtgggcgcatcagaatcttacgaa
cctcgctgtcgccattgtcatgtggtgaaaagttcaaaagcagcaagtaactttcaagaa
ctaaccaaataa

DBGET integrated database retrieval system