KEGG   Bordetella flabilis: BAU07_05100Help
Entry
BAU07_05100       CDS       T04592                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bfz  Bordetella flabilis
Brite
Enzymes [BR:bfz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BAU07_05100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ANN76576
UniProt: A0A193GAT1
LinkDB All DBs
Position
complement(1169545..1170087)
Genome map
AA seq 180 aa AA seqDB search
MKKSTQGLTLALAAMAASTAALSTTALADVAVPMFLATEQGPGARIGTVSLSDNKYGLVL
TPDLKGLPPGLHGFHIHEHGDCGPKEQNGKAVAAGAAGGHYDPDGSKKHGTPWGDGHRGD
LPALYVDAQGNAANPVLAPRLKLDDVHGRALMVHAGGDNHSDHPAALGGGGGRVACGVVP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatccacgcaaggtctgacactggcgcttgccgccatggccgcaagcacggcc
gccctcagcacgacggccctggccgacgtcgccgtgcccatgttcctcgccaccgagcaa
ggccccggagcgcgcatcggtacggtgtccctgtcggacaataaatacgggctcgtgctt
acgcccgacctgaagggcctgccgccgggcctgcatggtttccacattcacgagcacggc
gactgcggccccaaggagcagaacggcaaggccgtagccgccggcgcggcgggcgggcac
tacgatccggacggcagcaaaaaacacggcacgccctggggcgacggacaccgcggcgac
ctgcccgcgctgtacgtggacgcgcaaggcaacgcggccaaccccgtcctcgcgccgcgg
ctcaagctggacgacgtgcacggccgtgcattgatggtccatgccggcggggataaccac
agcgaccaccctgccgccctgggcggcggaggcggacgggtagcctgcggcgtggtgccc
tga

DBGET integrated database retrieval system