KEGG   Burkholderia gladioli BSR3: bgla_2g19620Help
Entry
bgla_2g19620      CDS       T01464                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
bgd  Burkholderia gladioli BSR3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:2489017..2490783
Genome map
AA seq 588 aa AA seqDB search
MGDSKLRRFDSMIDAILAAAEHPDTHRPALLAVIEDDGQERSLDYEVFAHRALAACAALH
EMGVRQRDLVILALPTSVDHLLALAGCVLLGAMPCTVPLPGRLATDSSKNQLYLACRTFS
PRLVIAPDPLAQGFRDDLANARTHVIAMSELRLAAQAGGTPVIGRRGPHEAHHVQLTSGS
TGRPKAAVLTHRNVLDNSYGIGGSVGYDTARGDASGSWLPLFHDLGLLTLLSNIAYQSPI
LLMQPSSFIRNPLGWLKRIAAFGATTTASPTFGLQYCVRRFREASMREVDLSRLRNIFIG
AERVDEACLRDFADRFGPYGLSRSALQPCYGMAESTLATTMHDATRNYDPRSLAYVVPDR
IDSEAVIKQGYALPARADSHLTESILSMGRPIPGMELRVIAPAGTQAHEREVGEIHIRGT
SIMSDYLPAEGQTERHDRDSWFATGDLGYLLGGELYVLGRKKEIIIIRGNNYFPHEIEDV
VAAHPGLSEAAIVAAGVFDEVQGTENIVLFIESETVDLMGELHRALQAALREAFGFGAQA
IVFVRNGSLPRTSSGKLQRLKCRDLYVQGRLAVVAEPEAARLEEPAAL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggagattcgaaattgcgcagatttgattcgatgatcgatgcgattctcgcggccgcc
gagcacccggacacgcatcgtccggcgctcctggccgtcatcgaggacgacggccaggag
cgcagcctcgactacgaggtgttcgcgcaccgcgcgctggccgcctgcgcggccctgcac
gagatgggcgtgcgccagcgcgacctggtgatcctggcgctgccgacctcggtcgaccat
ctgctggcgctggccggctgcgtgctgctgggcgcgatgccctgcaccgtgccgctgccg
gggcgcctggccaccgattcctcgaagaaccagctctatctcgcctgccgaaccttctcg
ccgcgcctggtgatcgctcccgacccgctcgcgcagggcttccgcgacgatctcgcgaac
gcgcgcacccacgtgatcgcgatgtcggagctgcggctggccgcccaggctggcggcacg
cccgtgatcggccggcgcggcccgcacgaggcgcatcacgtgcagctcacctcgggttcg
accggccgccccaaggccgccgtgctgacccatcgcaacgtgctcgacaacagctacggc
atcggcggctcggtcggctacgacaccgcgcgcggcgatgcgagcggtagctggctgccg
ctgttccacgatctcggcctgctcaccctgctgtcgaacatcgcctaccagtcgccgatc
ctgctgatgcagccctccagcttcatccgcaacccgctcggctggctcaagcggatcgcc
gccttcggcgcgaccaccaccgcctcgccaaccttcggcctgcaatactgcgtgcggcgc
ttccgcgaggcctcgatgcgcgaggtcgacctgagccgcctgcgcaacatcttcatcggc
gcggaacgcgtcgacgaggcctgcctgcgcgatttcgccgaccggttcggcccctacggg
ctgtcgcgctcggcgctgcagccctgctacggcatggccgagtcgacgctggccaccacc
atgcacgacgccacgcgcaactacgatccgcgctcgcttgcctacgtggtgccggaccgc
atcgattcggaagccgtgatcaagcagggctacgcgctgccggcgcgcgccgacagccat
ctcaccgagagcatcctgtcgatgggccgcccgatccccggcatggagctgcgggtgatc
gcgccggccggcacgcaggcgcacgagcgcgaggtgggcgagatccacatccgcggcacc
tcgatcatgtccgactacctgccggccgaaggccagaccgagcggcacgaccgcgacagc
tggttcgccaccggcgacctcggctacctgctcggcggcgagctctacgtgctcggtcgc
aagaaggaaatcatcatcatccgcggcaacaactacttcccgcacgagatcgaagacgtg
gtggccgcgcatccgggcctgagcgaggcggcgatcgtcgccgccggcgtgttcgacgag
gtgcagggcaccgagaacatcgtgctgttcatcgaatccgagacggtcgacctgatgggc
gagctgcaccgcgcgctgcaggccgcgctgcgcgaggccttcggcttcggtgcgcaggcc
atcgtgttcgtcaggaacggcagcctgccgcgcaccagcagcggcaagctgcagcgcctc
aagtgccgcgatctctacgtgcagggccggctcgcggtggtggccgagcccgaggccgcg
cgcctcgaggagccggccgcgctctga

DBGET integrated database retrieval system