KEGG   Burkholderia sp. CCGE1002: BC1002_6690Help
Entry
BC1002_6690       CDS       T01217                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
bge  Burkholderia sp. CCGE1002
Brite
Enzymes [BR:bge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     BC1002_6690
Lipid biosynthesis proteins [BR:bge01004]
 Acyl-CoA synthetase
  Unknown
   BC1002_6690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3:complement(1185405..1187075)
Genome map
AA seq 556 aa AA seqDB search
MDQTLVDAVSALPRGDARGLRFVSSHGDEHYYPYEALEREARKRAQKLVSLGLNKGERIA
LVILDPEAFILSFLGASFAGLVPVPIFPRGSLNFRTRERYAETVSHIVRSAGARMLLTSN
STRETIEDVLAADTGLERIVTVEALLDGEPPACDLPTLHPDDLCFLQYTSGSTSLPKGVM
VTHRNLIANATAFLGPRGIDLHEQDVYVSWLPLHHDMGLISVLGALICDLPSVLLSTEAF
VRRPGLWMEAITKYRGTISFAPNFAYALAARRTRDQDLEGLDLSRLRVAGCGAEPINAQA
LRQFSARFEPAGFRAEALLPCYGMAEATLAITFHDHGQPIVTDVVYAAPLGLGRAIPAAH
DTGLRTIELVGCGHCFPGHDLRIVDESGRGLPERCVGEIVTRGPSITAGYYGLADASADA
YRDGWLQTGDLGYVAGDQLYICGRSKDLIVIHGSNLYPQDIEWAVAELPSVQSRGVIAFS
VMRDGDETLVVCAEGKPAEATALRRAIAQKVAECAGLQVGHVAIVQAGSLPRTSSGKVQR
RRTKAQFEAGELEEHS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggaccagacgctagtcgatgccgtttcagcgctgccgcgcggcgacgctcgaggcctt
cgctttgtctcctcgcacggcgacgagcactactatccgtacgaggcactcgagcgcgag
gcacgcaagcgtgcgcaaaagctcgtgtcgctgggcttgaacaaaggcgagcgcatcgca
ctcgtgatcctcgacccggaagcgttcatcctgagcttcctcggcgcgtcgttcgccggt
ctggtgcccgtcccgatctttccgcgcggaagcctgaacttcagaacccgcgaacgctac
gccgaaaccgtcagtcacatcgtgcgctcggctggcgcgcgcatgctgctgacgtcgaac
tcgacacgcgagaccatcgaggacgtgctggccgccgacaccggcctcgaacgcatcgtc
accgtcgaagcgctgctcgacggcgagccgcccgcctgcgatttgcccacgctgcatccc
gacgacctgtgcttcctgcaatacacgtcgggcagcacgtcgctgccgaaaggcgtgatg
gtcacgcatcgcaatctgatcgcgaatgcgacagcgttcctcggcccccgcggcatcgat
ctgcacgagcaggatgtctatgtcagctggctgccgctgcaccacgacatgggactcatc
agcgtactcggcgcgctgatctgcgacttgccgagcgtgctgctatcaaccgaagcattc
gtgcgccggcccggcctgtggatggaggcgatcacgaagtaccgaggcacgatcagcttc
gcgcccaacttcgcgtacgcgctcgccgcgcgccgcacccgcgaccaggacctcgaaggc
ctggacctgagtcgtctgcgcgtagccggctgcggtgccgagccgatcaacgcgcaagcg
ctgcgccagttttccgcgcgcttcgaaccggccggttttcgcgccgaagcgctgctgccg
tgctacgggatggccgaagcaacgctcgcgatcacgtttcacgaccacggccagccgatc
gtcaccgacgtcgtctatgcggccccgctggggctcggtcgagcgataccggccgcgcat
gataccggcctgcgcacgatcgaactggtcggctgcggccattgctttcccggacacgat
ctgcggatcgtcgacgaatccgggcgtgggttgcccgaacgctgcgtcggcgagatcgtc
acgcgcggccccagcatcaccgcgggctactacggcctggccgacgcgagcgccgacgcg
taccgcgacggctggctgcagaccggcgatctcggctacgtcgccggcgaccagctttac
atctgcggccgcagcaaggacctgatcgtgattcacggttcgaacctctatccgcaggac
atcgaatgggcggtggccgagttgccgagcgtgcaaagccgcggcgtcatcgcgttcagc
gtgatgcgcgacggcgacgagacgctggtcgtctgtgccgagggcaagccggcggaggcc
acggcgctgcgccgtgcgatcgcgcagaaggtcgccgaatgcgcggggctgcaggtcggt
cacgtcgcgatcgtgcaggcgggaagcttgccgcgaacttcgagcggcaaggtgcaacgc
cgccggaccaaggcacagttcgaagccggcgagctggaggaacactcgtga

DBGET integrated database retrieval system