KEGG   Burkholderia sp. CCGE1003: BC1003_0593Help
Entry
BC1003_0593       CDS       T01314                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K16876  
2-furoate---CoA ligase [EC:6.2.1.31]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Furfural degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00365 Furfural degradation
    BC1003_0593
Enzymes [BR:bgf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.31  2-furoate---CoA ligase
     BC1003_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:670674..672236
Genome map
AA seq 520 aa AA seqDB search
MLDLGRTFLQSVERSPDALAIVDGELQLTYAQWHRMILNVADALRELGLQRGDRLLVVLQ
NRWEMATLHWAGQFLGVVIVPLNWRAKPDEVEYCVTDAGVKAIVYEPVCADAVVNSAAAQ
QLPRIGVDAAAGSTMSFDALLADRERARSANTTHASADDISLILYTSGTTGKPKGVPRRH
RHERAGALAHVAQNLYRRGERTLGVMPLYHTMGVRSLLSMALVDGVFVCVRRWNAKLALE
SIAKYRLTCLYLVPTLYHDLLADSAFAGTDTSSVRKLGFAGAPMNDGLLKRLSAAFRPEL
FVNHYGSSEIYTVSIDQDATRKPGSAGRAGLNTRLRVVRLDAVSPDEIAPAGEEGQIIAD
LLGDEAFEGYWNRPDANGKSLREGWYFTGDTGYFDRDGDLYVTGRVDDMIISGGENISPV
DIESVLSLHPAVDEVAVAGVRDERWGQRVVAFIKRRDHVDAEALDAWCRQSDLVNFKRPR
DYVFVDDIPKSPVGKILRRKLSAGEYASDGHAQPTQTTKE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatctcggccgcacctttctgcagagcgtcgagcgcagccctgacgcgctcgcg
atcgtcgatggcgaactgcaactgacctatgcgcagtggcatcgcatgattctgaatgtc
gccgatgctcttcgcgaacttggactgcaacgcggcgaccgcctgctcgtcgtgctgcaa
aaccgctgggaaatggcgacgctgcactgggcggggcaatttctcggcgtcgtgatcgtg
ccgctcaactggcgcgcgaagccggacgaagtcgagtactgcgtgacggatgcgggcgtg
aaggcgatcgtgtacgaacctgtttgcgccgatgccgtggtgaatagcgccgccgcgcag
cagttgccgcgcattggtgtggacgccgccgcgggcagcacgatgagcttcgacgcgctg
ttggccgaccgtgaacgcgcgcgcagcgccaacaccactcacgccagcgccgacgatatc
tcgctgatcctctacacgtccggcacgaccggcaagccgaagggcgtgccgcgccgccac
cggcacgagcgcgcgggcgcgctcgcgcacgttgcgcagaacctgtaccggcgcggcgag
cgcacgctcggtgtcatgccgctttatcacacgatgggcgtgcgctcgctgttgtcaatg
gcgctcgttgatggtgttttcgtgtgcgtgcgtcgctggaacgcgaaactcgcgctcgaa
tccatcgcgaagtaccgccttacgtgcctctatctcgtgccgacgctttatcacgatctg
ctcgcggacagcgcgtttgccggcaccgatacgtcgtcggtcagaaagctcggcttcgcg
ggggcaccgatgaacgatggtttgctcaagcgcctgtcggcagcgtttcggccggaactg
ttcgtcaaccactatggctcgtcggagatctacacggtcagcatcgaccaggacgcaacg
cgcaagccgggcagtgcggggcgcgcgggtctgaacacgcggctgcgtgtcgtcaggctc
gacgccgtctcgcccgacgagatcgcaccggctggcgaggaaggccagatcattgcggat
ctgctcggcgacgaagccttcgaaggctactggaaccgcccggacgcgaacggcaagtcg
ctgcgcgagggctggtatttcaccggcgacacgggctatttcgaccgcgacggcgacctg
tatgtgaccggccgtgtcgacgacatgattatcagcggcggcgaaaacatctcgccggtg
gatatcgagtcggtactttcgctgcatccggccgtcgatgaagtcgcggtggccggcgtc
agggacgagcgctggggccagcgcgtggtcgcgttcatcaagcgccgcgatcacgtggat
gccgaggcgctcgacgcctggtgccgccagtccgacctcgtcaacttcaagcgcccgcgc
gactacgtgttcgtcgacgacattccgaagtcgccggtcggcaagattctgcgccgcaag
ctttccgccggcgaatacgcatccgacggccacgctcaacctacacagaccaccaaggag
taa

DBGET integrated database retrieval system