KEGG   Burkholderia sp. CCGE1003: BC1003_4750Help
Entry
BC1003_4750       CDS       T01314                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
bgf  Burkholderia sp. CCGE1003
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2:1433670..1436513
Genome map
AA seq 947 aa AA seqDB search
MNENVMRPPPTDPQRLLDIADAFAKEVSPRGYRPHSVTLNSEFERDLGLDSLARTELLTR
VEKKLGVQFPVALFGQARTPGDLLRALEGARSGQPGCAVRPAELQAPPGALDPPVDAQTL
VEALQWHMSRRAEHSHIVFVDDDASSHTMTYAALYEAAQRVSGALRRLGVNPGDTVAMML
PTGSDYFACFAGILLIGAIVVPVYPPAQSARINDHLSRQAAILSDARARVMIVPSHALVA
SLLAKARVPTLQEIVAPAQLMGETDNERYVPRAEDAALLQYTSGSTGAPKGVVLSHANLL
ANLRAMGQTAQIGEGDIFASWLPLYHDMGLIGAWFGPLYYGIPLILMSPLTFLARPARWL
QAVSHYRATITAAPNFAYERCTRRIEEADLEGIDLSSLRLAFCGAEPVSASTMRAFAARF
ANYGFSKNALNPVYGLAENTLGLTFSEPGRGVRTDCISRARLSDSQRATPAESPDDVLEL
VSCGRALPHNEVRIVDVSGNEVSERTIGRIEFRSPSATRGYFLNPGLTAQLIHNGWLDTG
DLGYMAEEELFITGRVKDLVIRAGRHFFPYELEASVGRLRGVRSGCVAVCGAPDIERGTD
RLIVIAETRETAPEALATMQADINAASVALLGTPPEEVALVPPHSILKTSSGKIRHAATL
QLYLASRGNLSPRAPWLQWLDIAANTVRPIGRRASTTGARIAYGAWCWLLITMIAIPTWL
MTVWHPEITRNWRIASSAARLALKLARIRVTSRGVDAIDTARPAIFVANHASYLDGLLLL
ATLPMPLGIVAKRELAKALLIGPFLRAIGTRFVERVDYRRMAEDERELVKLATAGTSLLF
FPEGTFVRSAGLRQFRLGAFVTACASNRPIIPIAIAGARVVLPDGHLVPTRADITVTVLP
ALVPSGAELKAAANLRDAARDAIAGHCGERALSEISPLETPTRHREI
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaatgtcatgcgcccccctccgaccgacccccagcggttgctcgacattgcc
gatgctttcgccaaggaagtaagcccacggggatacaggccacatagcgtcacgctgaac
agcgagttcgagcgcgatcttggtcttgacagtctcgcgcgcactgaactgctgacccgc
gtcgaaaagaagctcggcgtgcagtttccggtcgccttgttcgggcaggcgaggacaccc
ggcgacttgctgcgcgcccttgaaggcgcacgatcgggccaacccggctgtgcggtccga
cccgcagagcttcaggcgccgccaggcgcgctggacccgccggtcgatgcgcaaacgctg
gtcgaagcgttgcagtggcacatgtcgcgccgagctgaacactcgcacatcgtatttgtc
gacgacgacgcttcgtcgcacacgatgacctacgccgcgctgtacgaggccgctcagcgg
gtatctggcgcgctgcgcaggctcggcgtgaaccctggtgacacggtcgcaatgatgtta
ccgacgggcagcgactatttcgcgtgctttgcgggcatcctgctcatcggggcgatagtc
gtaccggtatatccgcccgcacaatcggcacgaatcaacgatcatctgagtcgccaggcg
gccattctgtctgatgcgcgcgcccgcgtcatgatcgtgccgtcacacgcgctagtggca
agccttctggccaaggcgcgagtacctacgttacaggagatcgtcgcacccgctcagctc
atgggtgaaacggacaatgaacggtatgtgccgcgtgccgaagacgccgcgttgcttcag
tacacctccggcagtaccggcgcccccaaaggcgttgtgctcagccacgccaatctgctc
gccaacctccgggcgatgggacaaactgcccagatcggtgaaggcgacattttcgccagt
tggctgcctctttaccacgatatgggcctgattggagcctggttcgggccgctctactat
ggcatcccgctgattctgatgtccccgctgacgttcctcgctcgtccggcgcggtggttg
caggcagtcagccactaccgggctaccattacggccgcgcccaactttgcctatgagcga
tgcacgcgccgaatcgaagaggccgatctggaaggcatcgacctgtcctcgttgcgcctc
gcattttgcggcgcggagccggtcagcgcgtcaaccatgcgggcattcgcggcacgcttt
gccaactacgggttcagcaaaaacgcgttgaatccggtctacggtctggcggaaaacacg
ctcggactgacgttttcagagccgggccgaggggtgcgcacagactgtatcagccgcgcc
cgcctgtccgactcgcagcgtgcaacaccagcagaatcgcctgatgacgtgctcgagctg
gtctcgtgcgggcgtgcgttaccccataacgaggtccgcatcgtcgatgtcagcggcaat
gaagtgtccgaaagaacgatcggcagaatcgaattccgaagtccttccgctacgcgcgga
tattttctgaaccccgggctgaccgcacagttgattcacaatggctggctggacaccggc
gatctgggatacatggccgaagaagagctgttcatcacaggccgcgtgaaagatctggtc
atccgtgccgggcgccactttttcccatacgaactggaagcctcggtcggacgtctgcga
ggcgtgcgcagcggttgtgtcgcagtatgcggagcccccgacatcgagaggggcaccgat
cgcctgatcgtgattgcggagactcgcgaaacagcacctgaagcactcgcgacgatgcag
gcagacattaacgcagcctcagtggcgctgctgggtactccgccagaagaagttgctctg
gttccaccgcatagcattctaaaaacctccagcggcaagatccgccatgcagctacattg
caactgtacctggctagtcgcgggaatctctctccacgcgcaccgtggcttcagtggctc
gacatcgcggcgaacactgtacggccaatcggacggcgggctagcaccactggggcgcga
atcgcctacggtgcatggtgctggctgctcattaccatgatagcgattcccacatggttg
atgacagtatggcaccccgagatcacgcgaaactggaggatcgcatcgtctgcagcacgg
ctagccttgaagctggcacgcattcgcgtgacgtcacgcggtgtcgatgccatcgacacg
gcacggccggccatcttcgttgcaaaccacgcgagctatcttgacgggctcctcctgctg
gcgaccctccccatgccacttggcatcgttgcgaagcgcgagctggccaaggcattactg
ataggtccattcctgagggcaataggcacgcgtttcgtcgagcgcgtcgactaccgacgt
atggccgaggacgaacgtgaactggtaaagctggcgacggctgggacatcgctactcttc
tttcctgaagggaccttcgtcaggtcggctgggctgcggcagtttcgtcttggcgccttt
gtgacggcctgtgcatcaaaccgcccgatcatacccatcgccatcgcgggcgcgcgtgtt
gtacttccggatggacacctggtgccgacaagagccgacatcacggtcaccgtgctccct
gcactcgtaccatcaggagcagaattgaaggctgctgcgaatctacgtgatgctgcacgc
gatgccatagcaggccattgtggcgaacgggctctaagtgaaatttccccattggaaacg
cctacccgtcatcgagagatctga

DBGET integrated database retrieval system