KEGG   Burkholderia sp. CCGE1003: BC1003_5481Help
Entry
BC1003_5481       CDS       T01314                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K12508  
feruloyl-CoA synthase [EC:6.2.1.34]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
Enzymes [BR:bgf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.34  trans-feruloyl-CoA synthase
     BC1003_5481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2:complement(2237913..2239802)
Genome map
AA seq 629 aa AA seqDB search
MNSQPTQTRVDKEASVRYREVRIGSAPARVRRHGDVWYMESAAEPGAYPQRLTERLASGA
RAHPERWLVARRGADGAWRGISYAQMLQHARAIGQALLDRKLSAERPVAILSGNDLEHMM
IALGAMWAGVPYAPISPAYSLVSSDYGKLRHALELLTPGLVFATDAAAFATAIDTTVAAD
VEVVAATGSCGRAVTDLAALLDTTPVTVDAAHEAIAADSIAKFLFTSGSTTLPKAVPTTH
RMLCSNQQMLLETFPQFADEPPVLVDWLPWNHTFGGSHNAGIALYNGGTLYIDDGKPVAG
KFEETLRNLREIAPTIYFNVPKGWEELTSALETDAQLRETFFSRVKVFFFAGAGLSQAAW
DRLQQVTERHCGERIRIMAGLGMTETAPSCLFTTLPALCAGYVGVPAPGCEVKLVPVEGK
LEARYRGPHVMRGYWRMDHATSAQSFDEEGYYCSGDALKFVDPQQPELGLMFDGRIAEDF
KLSSGTFVSVGPMRARIISAGAPYVQDVVVTGLNRDDVGVLVFPRLDDCRRLAQLPASAS
VSEVVNAPAVRAFFADLLERLNRESTGGATLIARLRLLEVAPSLDLGEITDKGSINQRAV
LTHRAELVEALHDPVRRDPHAIYAAHVWS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcgcagccgacgcaaacccgtgtcgacaaggaggcatccgtgcgttatcgcgaa
gtgcggataggatcggcgcctgcacgcgtgcgtcgccatggcgacgtgtggtacatggag
tccgcagcggaacccggcgcgtatccacagcgcctgaccgagcggctcgcgagcggcgcg
cgtgcgcaccccgagcgttggctggtcgcgcgccgcggcgccgacggcgcatggcgcggc
atcagctacgcgcagatgctgcagcacgcgcgggccatcggccaggcgctgctcgatcgc
aagctgtcggctgagcggcccgttgcgattctctccggcaacgatctcgaacacatgatg
attgcgctcggcgccatgtgggccggcgtgccgtatgcaccgatttcgccggcgtattcg
ctcgtgtccagcgactacggcaagctgcgccacgcgctcgaactgctcacgcccggcctt
gtgttcgcgacggatgcagccgcgttcgcgaccgccatcgacacgaccgttgccgccgac
gtcgaggtcgtggccgccaccggctcatgcgggcgcgcggtgacggatctcgcggcgctg
ctcgacaccacgcctgtaacagtggatgctgcgcacgaggctatcgccgcggacagcatc
gccaaatttcttttcacctccggctccacgactttgccgaaggccgtgcccaccacacat
cgcatgctgtgcagcaaccagcagatgctgctcgaaacttttccgcagttcgccgacgag
ccgcccgttctggtcgactggttgccgtggaatcacacgttcggcggcagccataacgcg
ggtattgcgctttacaacggcggcacgctttatatcgacgacggcaagcccgtggccggc
aaattcgaggagacgctgcgcaatctgcgcgagatcgcacccaccatttacttcaacgtg
ccgaaaggctgggaagaattgacgagcgcactggaaaccgacgcgcaattgcgcgagacg
tttttctcgcgcgtaaaggtgtttttcttcgctggcgcagggctttcgcaggcagcgtgg
gaccgtttgcagcaggttaccgaacgccactgtggcgagcgcatccgcatcatggcgggc
ctcggcatgacggagaccgccccgtcgtgtctgttcacgacgctgccggccctgtgcgcg
ggctacgtgggcgtgccggcgccgggttgcgaagtgaagctcgtgcctgtagaaggcaag
ctcgaggcgcgctatcgcggcccgcatgtcatgcgcggctactggcgcatggaccatgca
acgtccgcacaatcgttcgacgaagaaggctattactgtagcggcgacgcgctcaaattc
gtggacccgcagcagcccgaactgggtctgatgttcgacggccgcattgccgaagacttc
aagctgagctcaggcaccttcgtgagcgtggggccgatgcgtgcccgaatcatctccgct
ggtgcgccgtatgtgcaggacgtagtggtcaccgggctcaatcgcgacgatgtcggcgtg
ctggtgttcccgcggctggacgactgccggcggctcgcgcaactgcccgcatccgcgagc
gtgtccgaagtggtgaatgcgcctgccgtgcgcgcgttttttgccgatctgctcgagcgg
ctcaatcgcgaatcgacgggaggcgcgacgctgattgcgcgcttgcgtttgctcgaggtc
gcgccttcgctggatctcggcgagatcaccgacaaaggctcgatcaatcagcgtgcggtg
ctcacgcatcgagcggaactggtggaggcgctgcatgatcccgtgcggcgcgacccgcac
gcgatttacgctgcgcacgtctggagctaa

DBGET integrated database retrieval system