KEGG   Bacillus gibsonii: BGM20_20830Help
Entry
BGM20_20830       CDS       T04820                                 

Definition
(GenBank) peptidase M4
  KO
K08777  
neutral peptidase B [EC:3.4.24.-]
Organism
bgi  Bacillus gibsonii
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:bgi00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BGM20_20830
Enzymes [BR:bgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BGM20_20830
Peptidases [BR:bgi01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BGM20_20830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4038761..4040377
Genome map
AA seq 538 aa AA seqDB search
MRNLTKTSLLLAGLCTAAQMVFVTHASADQSIKYDHTYQTPSYIIEKSPQKPVQNTTQKE
SLFSYLDKHQTQFKLKGNANSHFRVSKTIKDPKTKQTFFKLTEVYKGIPIYGFEQAVAMK
ENKQVKSFFGKVHPQIKDVSITPSISEKKAIHAARRELEASIGKIEYLDGEPKGELYIYP
HDGEYDLAYLVRLSTSEPEPGYWHYFIDAKNGKVIESFNAIHEAAGTGIGVSGDEKSFDV
REQNGRFYLADETRGKGINTFDAKNLNETLFTLLSQLIGYTGKEIVSSTSVFNEPAAVDA
HANAQAVYDYYSKTFGRDSFDQNGARITSTVHVGKQWNNAAWNGVQMVYGDGDGSKFKPL
SGSLDIVAHEITHAVTQYSAGLLYQGEPGALNESISDIMGAMADRDDWEIGEDVYTPGIA
GDSLRSLEDPSKQGNPDHYSNRYTGTEDYGGVHINSSIHNKAAYLLAEGGVHHGVQVEGI
GREASEQIYYRALTYYVTASTDFSMMKQAAIEAANDLYGEGSKQSVSVEKAYEAVGIL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaacctgaccaagacatctctattactggccggcttatgcacggcggcccaaatg
gtttttgtaacacatgcctcagctgatcaaagcatcaaatacgaccatacgtatcaaacc
ccttcatacatcatcgaaaagtcaccgcagaagccggtacaaaacacaacccagaaagaa
tcgctattttcctatcttgacaagcatcaaacgcagtttaagctcaaagggaatgcgaac
agccattttcgtgtttcgaaaaccataaaggatccaaagacaaaacaaacgttttttaaa
ttaacggaggtttacaaaggaattccgatttacggctttgaacaagcggtcgcgatgaag
gaaaacaaacaagtgaaaagtttctttggaaaggtgcatccgcaaatcaaggacgtctcc
atcacaccgtctatttctgagaaaaaagcaatacatgcagcaaggcgtgagctcgaggct
tccattggaaaaatcgaatatcttgatggggaaccaaaaggcgaattatatatctatcca
cacgacggtgaatatgatctcgcctaccttgtgagactctcgacatctgaacctgagcct
ggctattggcattatttcatcgatgccaaaaacggaaaggtcattgagtcctttaatgcc
attcatgaagcggcaggtacaggaatcggcgtatcaggtgatgaaaaaagctttgacgtc
agagaacaaaatgggcgcttttatttggctgacgaaacaaggggaaaagggatcaataca
tttgacgcgaagaacctgaacgaaaccttgtttacgcttttgtctcaactgatcgggtat
acgggcaaagaaatagtcagcagcacgtccgtatttaatgaacctgcggctgtagacgca
cacgcaaatgcgcaagccgtttacgattattacagcaagacatttggccgtgattctttt
gatcaaaacggagcaaggattacgtctaccgtgcatgtcggcaaacaatggaacaatgct
gcgtggaacggtgtccagatggtatacggggatggagacggttcgaaatttaagccgctg
tctggatcgctcgacattgtcgcgcatgaaatcacacacgcagtcacacagtattccgcc
ggtcttttatatcaaggagaacccggtgcattaaatgagtccatttctgacattatgggc
gcgatggctgaccgtgatgattgggagatcggcgaagatgtctatactcctggtattgca
ggagattcattgcggtcattggaggacccatctaagcagggaaatccagatcattactcg
aaccgctacacaggaacagaggattatggcggagtccatatcaattcgtccattcacaat
aaagcagcttatcttcttgcagaaggaggcgtgcaccacggtgtacaggttgaagggatt
gggcgtgaagcaagtgaacaaatttactatcgggctttaacatattatgtaacggcatct
acagatttcagcatgatgaagcaagcggcgattgaagctgccaatgatttatacggtgaa
ggctcaaagcaatcagtttcagtcgaaaaggcgtatgaggctgtcggcattctatga

DBGET integrated database retrieval system