KEGG   Brenneria goodwinii: AWC36_20500Help
Entry
AWC36_20500       CDS       T05061                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bgj  Brenneria goodwinii
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AWC36_20500 (glpD)
Enzymes [BR:bgj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AWC36_20500 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4695769..4697268)
Genome map
AA seq 499 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALSERETLLKMAPHIIFPMRFRLPHQPHLRPAWMIRIGLFMYDHIGKRVSLPAS
KSVKFGAGSVLKPELTQGFEYSDCWVDDARLVVLNAQEVIKRGGEVRTRTKVVSARREQG
LWVVEAVDERSGETLTWRAKGLVNATGPWVRQFFDDGLKLKSPYGIRLIKGSHIVVPKVH
DQPQAYILQNKDHRIVFVIPWQDEFSIIGTTDVEYHGDPHSVKIDDGEIDYLLDVYNDHF
KQPLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVDDEQGQAPLLSVFGGKLTTYRK
LAEHALDKLEKYYPQAGKAWTKDAVLPGGDISGTRDDYAAALRRRFNLPEALARRYSRTY
GSHSELILANVQGLSDLGEHFGHDLYEAELRYLVEKEWAVTLDDVIWRRTKLGMWLTEAQ
RQRISAWLDTYHHQVAEVS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgatcggtggcggcattaacggtgcaggtatcgccgcg
gatgcagccggtcgaggattatccgttctgctgctggaagcgcaggatctggcctgcgcc
acctcctccgccagttctaaattgatccatggcggcttacgctatctggaacattacgag
ttccgcctggtcagcgaagcgctatccgaacgtgaaacgctgctgaaaatggcgccccat
atcattttccccatgcgttttcgtttaccgcatcagccgcacctgcgtccggcatggatg
attcgtatcggcttgttcatgtatgaccacattgggaaacgcgtcagcctgcccgccagt
aaaagcgtgaaattcggtgccggatcggtattaaaaccagagctgactcaaggttttgag
tattcggactgctgggtagacgatgcgcgtttggtggtgttgaatgcacaggaagtcatc
aagcgcggtggggaagtgcgcacccgcaccaaggttgtcagcgcccggcgcgaacaaggt
ctgtgggtggttgaggccgtcgacgaacgcagcggcgaaacgctcacctggcgcgccaaa
ggcctggtgaacgcaaccggtccgtgggtaagacagttctttgatgatggcttaaaactg
aaatcgccttatgggatccgcctgatcaaaggcagccatattgtggtgcccaaggtgcac
gatcagcctcaggcatatattctgcaaaataaagatcatcgcattgtgtttgtgatcccc
tggcaggatgagttttcgatcatcggcaccaccgatgtggaatatcacggcgatccgcat
agcgtgaaaatcgacgatggcgagattgactacctgttggacgtttataacgatcacttt
aaacaaccgctcacccgagatgacatcgtctggacctattccggggtgcggccgctgtgc
gacgatgaatccgattcgccgcaggccattacccgcgattacacgctgtcggtggacgat
gaacagggtcaggctccgctgttatccgtgttcgggggcaaactgaccacctatcgcaaa
ctggcggaacatgcgctggataagctggaaaaatactaccctcaggcaggcaaggcctgg
accaaagacgccgtgctgcccggcggggatatctccggcacgcgcgatgactatgccgcc
gccctgcgccgccgtttcaatctgccggaagcgctggcgcggcgctatagccggacatac
ggatcacacagcgagctgattctggcgaatgtccaaggactcagcgatctgggcgaacat
ttcggtcacgatctgtatgaagccgaacttcgctatctggtcgagaaagagtgggccgtc
acattggacgacgtcatttggcggcgcacgaaattggggatgtggttaactgaggcgcag
cggcagcgcatcagcgcgtggctggatacataccaccatcaggtagccgaagtcagttaa

DBGET integrated database retrieval system