KEGG   Burkholderia glumae BGR1: bglu_1g29390Help
Entry
bglu_1g29390      CDS       T00905                                 

Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    bglu_1g29390
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     bglu_1g29390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3326331..3327581
Genome map
AA seq 416 aa AA seqDB search
MNSREDALALDRDDPLAALRGRFLLPDDTIYLDGNSLGARPAAAAARAQAVIADEWGRDL
IRSWNTAGWFALPRRLGDRLAPLIGAASGEVTITDTISVNLFKLLSAMLREQAKRAPERR
VIVSERSNFPTDLYIAQGLIAQLDRGYTLRLVDDPAELEAAIDAQTAVAMITHVNYRTGY
LHDMPAVTRHAQQAGALMLWDLAHSAGAVPVDLNGAGADGAVGCTYKYLNGGPGSPAFVW
VPQRHLAQFEQPLSGWWGHRAPFAMEPGFAPDAGIARFQCGTQPIVSMAMVECGLDIFHE
TDMQTIRRKSLALSDAFIALVERRCAGLDLTLVTPREHARRGSQVSFEHPHGYEVMRALI
ARGVIGDYREPRILRFGFTPLYTRYADVWDAVEVLREILETRAWQAPEFAARTAVT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacgtgaagacgcactcgcgctcgatcgcgacgaccccctcgccgccctgcgc
ggccgcttcctgctgcccgacgacacgatctacctcgacggcaactcgctcggcgcgcgg
ccggccgctgcagccgcgcgcgcgcaggccgtgatcgccgacgaatggggccgcgacctg
atccgcagctggaacaccgcgggctggttcgcactgccgcgccgcctcggcgaccgcctc
gccccgctgatcggcgcggcgagcggcgaggtgacgatcaccgacacgatctcggtgaac
ctgttcaagctgctctcggcgatgctgcgcgagcaggccaagcgcgcgcccgaacgccgc
gtgatcgtctccgagcgctcgaacttcccgaccgatctctacatcgcgcagggcctcatc
gcccagctcgatcgcggctacacgctgcgcctcgtcgacgatccggccgaactcgaagcg
gcgatcgacgcgcagacggccgtggccatgatcacgcacgtgaactaccgcaccggctac
ctgcacgacatgccggccgtcacgcgccacgcgcagcaggccggcgcgctgatgctgtgg
gatctcgcgcattcggccggcgcggtgccggtcgacctgaacggcgccggcgcggacggc
gcggtcggctgcacctacaagtacctgaacggcggccccggctcgccggccttcgtctgg
gtgccgcagcgccacctcgcgcagttcgagcagccgctctcgggatggtggggccaccgc
gcgccgttcgcgatggagcccggcttcgcgcccgacgccggcatcgcgcgcttccagtgc
ggcactcagccgatcgtctcgatggcgatggtggagtgcgggctcgacatcttccacgag
accgacatgcaaacgatccgccgcaagtcgctcgcgctctccgatgccttcatcgcgctc
gtcgagcgccgctgcgccgggctcgacctgacgctcgtcacgccgcgcgagcatgcgcga
cgcggctcgcaggtcagcttcgagcacccgcacggctacgaggtgatgcgcgcgctgatc
gcgcgcggcgtgatcggcgactaccgcgagccgcgcatcctgcgcttcggcttcacgccg
ctctacacgcgctacgcggatgtctgggacgccgtggaggtgctgcgcgagatcctcgag
acccgggcctggcaggcgcccgaattcgccgcgcgaaccgccgtgacctga

DBGET integrated database retrieval system