KEGG   Burkholderia glumae BGR1: bglu_2g11980Help
Entry
bglu_2g11980      CDS       T00905                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00010  Glycolysis / Gluconeogenesis
bgl00520  Amino sugar and nucleotide sugar metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_2g11980
   00520 Amino sugar and nucleotide sugar metabolism
    bglu_2g11980
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     bglu_2g11980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACR31584
UniProt: C5AI54
LinkDB All DBs
Position
2:complement(1532943..1533743)
Genome map
AA seq 266 aa AA seqDB search
MKPSQKPSTKPHDTHHAADAAGSAERILSIDIGGSGLKAAVVDTGANMLGERVRVPTPHP
CPPALLVETLHTLVAPLIASQAPSRVSIGFPGFVRDNRVLTAPHIGPDGWRDVPLAALLG
ERLGIAAVRMINDAEMQGLAAIEGRGLEFVLTLGTGAGTALYRDGELMPHLELAHHPVSR
KHAYDEYIGDAARRKAGNRRWSRRVAKVIGILESLVHYDRLWIGGGNAARLKLELPPNVA
TVPNDRGIEGGALLWHPRSVRETRQG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgagccagaaaccgagcacgaaaccccatgacacgcaccacgcggccgatgcg
gcgggcagcgccgagcgcatcctctcgatcgacatcggcggcagcgggctgaaggcggcc
gtggtcgacaccggcgccaacatgctcggcgagcgcgtgcgcgtgccgacgccgcacccg
tgtccgccggcgctactggtcgagacgctgcatacgctggtcgcgccgctgatcgcgagc
caggcgccgtcgcgcgtgtcgatcggctttcccggcttcgtgcgcgacaaccgcgtgctg
acggcgccgcatatcggcccggacggctggcgcgacgtgccgctcgcggcgctgctgggc
gagcggctcggcatcgccgcggtgcgcatgatcaacgacgccgagatgcagggtctggcc
gcgatcgaggggcgcggcctggagttcgtgctgacgctcggcaccggcgccggcacggcg
ctgtaccgcgacggcgaactgatgccccatctcgaactcgcgcatcatccggtcagccgg
aagcacgcctatgacgaatacatcggcgacgcggcgcgccgcaaggccggcaaccggcgc
tggagccggcgcgtggcgaaggtgatcggcatcctcgaatcgctcgtgcattacgaccgg
ctctggatcggcggcggcaatgccgcccggttgaagctggaactgccgccgaacgtggcg
acggtgcccaatgatcgcggcatcgagggcggggcgctgctgtggcatccgcgctcggtg
cgcgagacgcggcagggctga

DBGET integrated database retrieval system