KEGG   Burkholderia glumae BGR1: bglu_2g12870Help
Entry
bglu_2g12870      CDS       T00905                                 

Definition
(GenBank) Saframycin Mx1 synthetase
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1653789..1659248
Genome map
AA seq 1819 aa AA seqDB search
MRRARADPDSRPTRPDIGSAQAARERPSLLKRITSMPYRSATMNAFEATMSRFDHLHNFG
QCLRHWAAVKPHDTAFRFLTDGVVEAPRLSFAELDRRATAIAARLARECPRGEPVLLLYR
PGLDFIAAFFGCLYAGCAAVPAYPPSGRATRRNRLAAIIADCGAGAILTSDELVEAIREE
IAQADVPSRAGVIGTDALLAAPGEASDADGAALPASHLAFLQYTSGSTGRPKGVRVTHRN
LLANERAIREGFGHGPDTVFVGWCPLYHDMGLIGNVLQPVYLGIPSVLMSPFEFLQQPLK
WLRAISTYGATTSGGPNFAYELCATRIAEADKAGLDLSSWRVAFNGAEPIRASTLDKFAA
AFADYGFDAGAMFPCYGMAETTLFVSGAVPGAGALTRRVDALALQAGRCVDAADGQPAAE
LVSSGRVGGDQQVRIVDPHSLRARGPGEIGEIWVRGGSVADGYWNREDDTRAQFDARIAG
EDSPPFLRTGDLGLLDGGELYVTGRLKELIIIRGRNHYPTDIEQTVEQSSADFRAGCGAA
FAIDGEDGERLVVVQEIQRAVRKSLDAEEAGRRAAAAVAAAHGIPLHELVLVQAGVVPKT
SSGKNQRTLVRQHYLNGELPVLARVRPGAGAEAAAPALPAAPGDGVDALRERVIAAMLGA
TGAARPEARATSTLALGLDSLALVDLQTRLAREFGIGVALDELMDDRPVAELAHELAARA
LDGGAIDGATGGEATAPPPPAVDPTALTPYQEAIWTAQLWDPSSPCFNLVLPLRIRAPLS
ATQVREALAALTVAHPNLASRFVQDGDGQLRQQPATASAGLLDVINCAGQSDDALRARIV
AATGVPLDLSAGPVFRAELLSRAPDDHVLVLIAHHLVADLGSLQTVLADFAEFHACLAEG
RPLPARATAPDYRARLAALLHEPQAEADRQYWAARLATPIEPLALPLALPGEAPAGRVAG
AGMSVDIDLDAALTGALDTLCAGQRVTRNMALLAAFFAFLHRYTAQRDLAVVTPAAVRPG
GEFDDWVGYGVNLLVIREAVDGELPFTALLAAMKQTVAGALAHRTTPFIDLARRFARRDA
DVRHPFSRILFAYHNLNRLPQAADLLAGAAGQPLTVGTLALESFPVPTPAAQTDLALVAI
QAGERLVLRFEYDATLASRAAVERMAAHFRTLLGALIARPDQPVARAALLEAAERERQLV
TWNHRPLPAVPAGANVAAEHATVHAMIDAMACRVPERIAVRTDTEHLDYARLRHDSDALA
AALHARGVRHGDVVGVGLPRDVRLPVMLLAIWKAGAAYLPIDLGVPAERVRQMLDDAQAT
LIVAPAALQSALGDDGRTWVTPEALAADAPAAASPVAPDARAGRESLAYVLFTSGSTGRP
KGVEIEHRNVLSLLAWIGACYTADELAAVFAGTSIAFDISVFELFGPLAHGGCVVIGENP
ATPPATPVSLINTVPSAAAALLETGRLPAGVVTVNLAGEPLRQSLVDALYARGTIGKVYD
LYGPTEDTVYSTAVLREPGGFDTIGTPLPGKRVYLLDAQGEPVPVGVAGELYLAGDGQAR
GYRHRPDLTEHAFVSVPALVDLEPRLYRTGDIGRQLADGRIVLSGRRDHQVKIRGHRVEL
GEIEAVLLRHPAVRDAVVVQTRHTAPAGDGGDGQDALLVAYLASGDVPGEAGGIDAVREF
AAASLPSYMRPAGYVLLEALPRNGSGKVDRAALPRFDPFAHDAAAAPASDAQRAVLAIWE
EVLGLHGFSIHADLFELGGHSLQVIRILTRCREHFGVEIPVREVLERTTVADLAAYITLL
AARSGAADEPGGAREEVLL
NT seq 5460 nt NT seq  +upstreamnt  +downstreamnt
ctgaggagagcgcgcgccgatcctgactcccgtccgacacgccctgacatcgggtccgcg
caagcggcccgcgaacgcccttcccttctcaagcgtattacctcgatgccgtaccggagc
gcgacgatgaatgcctttgaagccacaatgagtcggttcgatcatctgcacaattttggc
caatgcctgcgtcactgggcagcggtcaaaccgcacgacaccgcgttccggttcctgacc
gacggtgtcgtcgaggcgccgcgactgagcttcgccgaactcgaccgacgcgccaccgcg
atcgccgcccgcctcgcgcgcgaatgcccgcgcggcgagcccgtgttgctgctctatcgg
cccgggctcgacttcatcgccgcgtttttcggctgcctctacgcgggctgcgcggcggtg
ccggcttatccgccgtcgggccgcgccacgcgtcgcaatcggctcgccgcgatcatcgcc
gactgcggcgccggcgcgatcctgaccagcgacgagctggtcgaggcgatccgcgaggag
atcgcgcaggccgacgtgccgtcgcgcgcgggcgtgatcggcaccgacgcgctgctggcc
gcgccgggcgaggcgtccgacgcggacggggccgcgctgcccgccagccatctggcgttc
ctgcaatacacctcgggctccaccggccgccccaagggcgtgcgcgtcacgcaccgcaac
ctgctcgccaacgagcgggcgatccgcgagggcttcggccacggtccggacacggtgttc
gtcggctggtgcccgctttatcacgacatgggcctgatcggcaacgtgctgcagcccgtc
tatctcggcatcccgtcggtgctgatgtcgccgttcgagttcctgcagcagccgctcaag
tggctgcgcgcgatctcgacctacggcgccaccaccagcggcggcccgaacttcgcctac
gaactctgcgcgacgcgcatcgccgaggccgacaaggccgggctcgatctgtcctcgtgg
cgcgtcgcgttcaacggcgccgaaccgatccgcgcctcgacgctcgacaagttcgcggcg
gcgttcgccgactacggcttcgacgcgggcgcgatgttcccgtgctacgggatggccgag
accacgctgttcgtgtcgggcgccgtgcccggtgccggcgcgctcacgcgccgcgtcgac
gcgctcgcgctgcaggccgggcgctgcgtcgacgcggccgacgggcagcctgccgccgag
ctggtgagttcggggcgcgtgggcggcgaccagcaggtgcgcatcgtcgatccgcacagc
ctgcgcgcgaggggccccggcgagatcggcgagatctgggtgcgcggcggcagcgtcgcc
gacggctactggaaccgcgaggacgacacgcgcgcccagttcgacgcccgcatcgccggg
gaggactcgccgccgttcctgcgcaccggagatctcggcctgctcgacggcggcgaactc
tacgtgacgggccggctcaaggagctgatcatcatccgcgggcgcaaccactacccgacc
gacatcgagcagaccgtcgagcagagcagcgccgacttccgcgccggttgcggcgcggcc
ttcgcgatcgacggcgaggacggcgagcgcctggtggtcgtgcaggagatccagcgcgcc
gtgcgcaaatcgctcgacgccgaggaggccgggcggcgcgccgccgccgcagtggccgcc
gcgcacggcatcccgcttcacgagctggtactggtgcaggccggcgtggtgccgaaaacg
tcaagcggcaagaaccagcgcacgctggtgcgccagcattacctgaacggcgagctgccg
gtgctcgcgcgcgtgcggccgggagcgggcgccgaggccgccgcgccggcgttgccggcc
gcgccgggcgacggcgtcgacgcactgcgcgagcgcgtgatcgccgcgatgctcggcgcg
acaggcgcggcgcgccccgaggcgcgggccacctccacgctcgcgctcggcctcgattcc
ctcgcgctcgtcgatctgcagacgcgccttgcgcgcgagttcggcatcggggtggcgctc
gacgaactgatggacgaccggcccgtggcggagctcgcgcatgagctggccgcacgtgcg
ctcgacggcggcgcgatcgatggcgcaaccggcggcgaggcgaccgcgcccccgccgccc
gccgtcgaccccaccgccctgacgccctaccaggaggcgatctggacggcgcagctgtgg
gacccgtcctcgccctgcttcaacctggtgctgccgctgcgaatccgggcgccgctctcg
gccacgcaggtgcgggaggcgctcgcggcgctgacagtcgcccatcctaacctcgcgagc
cgcttcgtccaggacggcgacggccagctgcggcagcagccggcaacggcgtcggccggg
ctgctcgacgtgatcaactgcgcggggcagtccgacgacgcgctgcgcgcgcgcatcgtc
gccgccaccggcgtgccgctcgacctgtccgccggccccgtgttccgcgccgaactgctg
agccgcgcgcccgacgatcacgtactggtgctgatcgcccatcacctggttgccgatctc
ggctcgctgcagacggtgctggccgacttcgccgaattccacgcgtgcctcgccgagggc
cgtccgctgccggcgcgggccaccgcgcccgactatcgcgcccggctcgccgcgctgctg
cacgaaccgcaggccgaggccgaccggcaatactgggccgcgcgcctcgccaccccgatc
gaaccgctggcgctgccactggcactgcccggcgaggccccggcgggccgcgtggccggc
gcgggtatgagcgtggacatcgacctcgacgccgcgctgacgggcgcgctcgacacgctc
tgcgccggccagcgcgtgacgcgcaacatggcgctgctggcggcgttcttcgcgttcctg
catcgctacacggcacagcgcgacttggcggtggtcacgccggcggccgtgcggcccggc
ggcgagttcgacgattgggtcggctacggcgtgaacctgctggtgatccgcgaggcggtg
gacggcgagctgccgttcaccgcgctgctcgccgcgatgaagcagaccgtggccggcgcg
ctcgcccaccgcacgacgccgttcatcgacctggcgcggcgcttcgcgcggcgtgacgcc
gacgtgcgccatccgttctcacgcatcctgttcgcctatcacaacctgaaccgcctgccg
caggccgccgacctgctggcgggcgcggcgggccagccgctcacggtcggcacgctcgcg
ctcgaaagcttcccggtgcccaccccggccgcgcaaaccgacctcgcgctggtcgcgatc
caggccggcgagcggctcgtgctgcgtttcgagtacgacgccacgctcgcctcgcgcgcc
gcggtcgagcgcatggccgcgcatttccgcacgctgctcggcgcgctgatcgcccgaccc
gaccaaccggtcgcgcgggccgcgctgctggaggcggcggagcgcgagcggcagctcgtg
acatggaaccaccggccactgccggccgtgccggccggcgcgaacgtggcggcggagcac
gccacggtccacgcgatgatcgacgcgatggcgtgccgcgtgcccgagcgcatcgccgtg
cgcaccgacaccgagcacctggactatgcgcggctgcggcacgactccgacgcgctggca
gccgcgctgcacgcgcgcggcgtgcgccacggcgacgtggtgggtgtgggcctgccgcgc
gacgtgcgcctgccggtgatgctgctggcgatctggaaggccggtgccgcctatctgccg
atcgacctcggcgtgccggccgaacgcgtgcgccagatgctggacgacgcgcaggccacg
ctgatcgtcgcgcccgccgcgctgcagagcgcgctcggcgacgacggccgcacctgggtc
acgcccgaggcgctcgcggcggatgcgccggcggccgcctcgccggtcgcgcccgacgct
cgcgccggccgcgaaagccttgcctacgtgctgttcacgtccggctcgaccgggcgcccg
aagggcgtggaaatcgagcatcgcaacgtgctgtcgctgctcgcgtggatcggcgcctgc
tacacggccgacgagctggccgccgtgttcgcgggcacctcgatcgcgttcgacatctcg
gtgttcgagctgttcggcccgctcgcgcacggcggctgcgtggtgatcggcgagaacccg
gccacaccgcccgccaccccggtgtcgctgatcaacaccgtgccgtcggcggcggcggca
ctgctggagacgggcaggctgccggccggcgtggtgaccgtcaaccttgccggcgaaccg
ctgcgccagtcgctggtggacgcgctgtatgcgcgcggcacgatcggcaaggtctacgac
ctctacgggccgaccgaggacaccgtctactcgaccgcggtgctgcgcgagccaggcggc
ttcgacaccatcggcacgccgctgccgggcaagcgcgtctacctgctcgacgcgcagggc
gagccggtgccggtgggcgtggcgggcgagctatacctggccggcgacggccaggcgcgc
ggctaccgccaccggcccgacctgaccgagcatgcgttcgtctcggtgccggcgctggtc
gacctcgagccacggctctaccgcaccggcgacatcggccgccagttggcagacggccgc
atcgtgctgtcgggccggcgtgaccaccaggtgaagatccgcggccaccgcgtcgaactc
ggcgagatcgaggccgtgctgctgcggcacccggcggtgcgcgatgccgtggtggtgcag
acgcgtcacaccgcgccggccggtgacggcggcgacggccaggacgcgctgctggtcgcc
tacctggccagcggcgacgtgccgggcgaggccggcggcatcgacgcggtgcgcgagttc
gcggccgcctcgttgccgagctacatgcgtcccgccggctatgtgctgctcgaggcgctg
ccgcgcaacgggagcggcaaggtggaccgcgccgcgctaccgcgcttcgacccgttcgcg
catgacgccgccgccgcgccggccagcgacgcgcagcgcgcggtgctggcgatctgggag
gaggtgctcggcttacacggcttcagcattcatgccgacctgttcgagctcggtggccat
tcgctgcaagtgatccggatcctcacgcgctgccgcgagcacttcggcgtcgagattccc
gtgcgcgaggtgctggagcgcaccacggtggccgacctggccgcctacatcacgttactg
gcggcgcgctccggcgccgccgacgagcccggcggcgcccgggaggaggtgctgttgtga

DBGET integrated database retrieval system