KEGG   Burkholderia gladioli ATCC 10248: BM43_5245Help
Entry
BM43_5245         CDS       T03826                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00010  Glycolysis / Gluconeogenesis
bgo00520  Amino sugar and nucleotide sugar metabolism
bgo01100  Metabolic pathways
bgo01110  Biosynthesis of secondary metabolites
bgo01120  Microbial metabolism in diverse environments
bgo01130  Biosynthesis of antibiotics
bgo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BM43_5245
   00520 Amino sugar and nucleotide sugar metabolism
    BM43_5245
Enzymes [BR:bgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BM43_5245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AJW96390
UniProt: A0A095FCL1
LinkDB All DBs
Position
2:1415581..1416372
Genome map
AA seq 263 aa AA seqDB search
MKPGKKPSTKPHDAADSTGARDAGPTLSIDIGGSGLKAAIVDADATLRSKRVRVATPHPC
PPDLLVETLHGLVAPLLARDPVAQVSIGFPGFVRDNHVLTAPHLGGPEWRDVPLAARLGE
RLGIAAVRMINDAEMQGLAAIEGRGLEFVLTLGTGAGTALFRDGELMPHLELAHHRVSKK
HAYDEYIGDAARRKAGNARWNHRVEKVIGILESLVHFDKLWIGGGNAARLKFGLPANVAT
VPNDRGIEGGALLWHPRSMRETR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaggcaagaaaccgagcaccaagccgcatgacgcggccgattccaccggcgcg
cgcgacgccgggccgaccctgtcgatcgacatcggcggcagcggcctcaaggcggcgatc
gtcgacgccgacgccacgctgcgctccaagcgtgtgcgggtggcgacgccgcatccatgt
ccgccggacctgctggtcgagacgctgcacgggctggtcgcgccgctgctggcgcgcgat
ccggtcgcgcaggtctcgatcggctttccggggttcgtgcgcgacaaccacgtgctgacg
gcgccccatctgggcggccccgagtggcgcgacgtgccgctcgcggcgaggctgggggag
cggctcggcatcgccgccgtgcgcatgatcaacgatgccgagatgcaggggctcgcggcg
atcgaggggcgcggcctggagttcgtgctgacgctcggcaccggggcgggcacggcgctg
tttcgcgacggcgagctgatgccgcatctcgaactcgcccatcatcgcgtcagcaagaag
cacgcgtatgacgagtacatcggcgacgccgcgcgccgcaaggccggcaacgcgcggtgg
aaccatcgcgtcgagaaagtgatcggcatcctcgaatcgctcgtgcatttcgacaagctc
tggatcggcggcggcaacgccgcgcgtctcaaattcgggctgccggccaatgtcgcgacc
gtgccgaacgatcgcggcatcgagggcggcgcgctgctgtggcatccgcgctcgatgcgc
gagacgcgctga

DBGET integrated database retrieval system